Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 4543821..4544409 | Replicon | chromosome |
| Accession | NZ_LR134485 | ||
| Organism | Citrobacter youngae strain NCTC13709 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | EL296_RS22485 | Protein ID | WP_124021092.1 |
| Coordinates | 4543821..4544138 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | EL296_RS22490 | Protein ID | WP_124021093.1 |
| Coordinates | 4544131..4544409 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL296_RS22455 | 4539673..4540485 | + | 813 | WP_124021087.1 | shikimate 5-dehydrogenase | - |
| EL296_RS22460 | 4540533..4540826 | - | 294 | WP_124021088.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| EL296_RS22465 | 4540922..4541287 | - | 366 | WP_124021089.1 | hypothetical protein | - |
| EL296_RS24180 | 4541419..4541592 | + | 174 | WP_032938222.1 | hypothetical protein | - |
| EL296_RS22470 | 4541663..4541824 | + | 162 | WP_005132808.1 | hypothetical protein | - |
| EL296_RS22475 | 4541971..4542477 | - | 507 | WP_124021090.1 | HNH endonuclease | - |
| EL296_RS22480 | 4542692..4543432 | - | 741 | WP_124021091.1 | DUF2971 domain-containing protein | - |
| EL296_RS22485 | 4543821..4544138 | + | 318 | WP_124021092.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL296_RS22490 | 4544131..4544409 | + | 279 | WP_124021093.1 | putative addiction module antidote protein | Antitoxin |
| EL296_RS22495 | 4544519..4545208 | + | 690 | WP_032942056.1 | dipeptidase PepE | - |
| EL296_RS22500 | 4545270..4546901 | - | 1632 | WP_124021094.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11997.89 Da Isoelectric Point: 10.1424
>T287941 WP_124021092.1 NZ_LR134485:4543821-4544138 [Citrobacter youngae]
IMEILQTTVFQRWEQNLRDRRAKTLIAARLFRLANGLAGDVKPVGEGISEMRISYGPGYRIYFKQHGCRIIILLCGGDKS
SQANNITLAKVLARSLDYQETFRHE
IMEILQTTVFQRWEQNLRDRRAKTLIAARLFRLANGLAGDVKPVGEGISEMRISYGPGYRIYFKQHGCRIIILLCGGDKS
SQANNITLAKVLARSLDYQETFRHE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|