Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4287424..4287940 | Replicon | chromosome |
Accession | NZ_LR134485 | ||
Organism | Citrobacter youngae strain NCTC13709 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0D7LMW6 |
Locus tag | EL296_RS21225 | Protein ID | WP_003839578.1 |
Coordinates | 4287424..4287708 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | EL296_RS21230 | Protein ID | WP_003839576.1 |
Coordinates | 4287698..4287940 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL296_RS21210 | 4282650..4284302 | + | 1653 | WP_124020778.1 | alpha,alpha-phosphotrehalase | - |
EL296_RS21215 | 4284711..4286849 | + | 2139 | WP_048212844.1 | anaerobic ribonucleoside-triphosphate reductase | - |
EL296_RS21220 | 4286956..4287420 | + | 465 | WP_124020779.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
EL296_RS21225 | 4287424..4287708 | - | 285 | WP_003839578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL296_RS21230 | 4287698..4287940 | - | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EL296_RS21235 | 4288018..4289931 | - | 1914 | WP_124020780.1 | BglG family transcription antiterminator | - |
EL296_RS21240 | 4289953..4290693 | - | 741 | WP_124020781.1 | KDGP aldolase family protein | - |
EL296_RS21245 | 4290690..4291808 | - | 1119 | WP_101743297.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
EL296_RS21250 | 4291792..4292925 | - | 1134 | WP_101743296.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10866.68 Da Isoelectric Point: 10.0482
>T287939 WP_003839578.1 NZ_LR134485:c4287708-4287424 [Citrobacter youngae]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
REHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7LMW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MV10 |