Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3649432..3650051 | Replicon | chromosome |
| Accession | NZ_LR134485 | ||
| Organism | Citrobacter youngae strain NCTC13709 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | EL296_RS18235 | Protein ID | WP_002892050.1 |
| Coordinates | 3649833..3650051 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | R8WZW8 |
| Locus tag | EL296_RS18230 | Protein ID | WP_003021733.1 |
| Coordinates | 3649432..3649806 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL296_RS18220 | 3644578..3645771 | + | 1194 | WP_048212410.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL296_RS18225 | 3645794..3648943 | + | 3150 | WP_048212411.1 | efflux RND transporter permease AcrB | - |
| EL296_RS18230 | 3649432..3649806 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
| EL296_RS18235 | 3649833..3650051 | + | 219 | WP_002892050.1 | hemolysin expression modulator Hha | Toxin |
| EL296_RS18240 | 3650260..3650790 | + | 531 | WP_126320197.1 | maltose O-acetyltransferase | - |
| EL296_RS18245 | 3650907..3651377 | + | 471 | WP_040232692.1 | YlaC family protein | - |
| EL296_RS18250 | 3651455..3651595 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
| EL296_RS18255 | 3651597..3651857 | - | 261 | WP_124021513.1 | type B 50S ribosomal protein L31 | - |
| EL296_RS18260 | 3652046..3653599 | + | 1554 | WP_048212413.1 | EAL domain-containing protein | - |
| EL296_RS18265 | 3653654..3654007 | - | 354 | WP_061067436.1 | DUF1428 family protein | - |
| EL296_RS18270 | 3654090..3654701 | - | 612 | WP_061067435.1 | membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T287938 WP_002892050.1 NZ_LR134485:3649833-3650051 [Citrobacter youngae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT287938 WP_003021733.1 NZ_LR134485:3649432-3649806 [Citrobacter youngae]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R8WZW8 |