Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1785287..1785877 | Replicon | chromosome |
| Accession | NZ_LR134485 | ||
| Organism | Citrobacter youngae strain NCTC13709 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | EL296_RS08595 | Protein ID | WP_124022134.1 |
| Coordinates | 1785545..1785877 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | EL296_RS08590 | Protein ID | WP_079816675.1 |
| Coordinates | 1785287..1785544 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL296_RS08570 | 1782299..1783903 | + | 1605 | WP_124022136.1 | hypothetical protein | - |
| EL296_RS24220 | 1783977..1784736 | + | 760 | Protein_1636 | ash family protein | - |
| EL296_RS08580 | 1784733..1784939 | + | 207 | WP_023187060.1 | helix-turn-helix domain-containing protein | - |
| EL296_RS08590 | 1785287..1785544 | + | 258 | WP_079816675.1 | antitoxin | Antitoxin |
| EL296_RS08595 | 1785545..1785877 | + | 333 | WP_124022134.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL296_RS08610 | 1786721..1787608 | + | 888 | WP_124022132.1 | integrase domain-containing protein | - |
| EL296_RS08620 | 1788607..1789869 | - | 1263 | WP_124022039.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11723.54 Da Isoelectric Point: 10.1863
>T287933 WP_124022134.1 NZ_LR134485:1785545-1785877 [Citrobacter youngae]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTQLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTQLPVVVPVTSGGNFARAAGFTVSLDGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|