Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 1124420..1125087 | Replicon | chromosome |
| Accession | NZ_LR134485 | ||
| Organism | Citrobacter youngae strain NCTC13709 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | EL296_RS05510 | Protein ID | WP_057064441.1 |
| Coordinates | 1124420..1124749 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | EL296_RS05515 | Protein ID | WP_007870247.1 |
| Coordinates | 1124770..1125087 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL296_RS05495 | 1121078..1121536 | - | 459 | WP_048212960.1 | GNAT family N-acetyltransferase | - |
| EL296_RS05500 | 1121663..1123131 | + | 1469 | Protein_1047 | PLP-dependent aminotransferase family protein | - |
| EL296_RS05505 | 1123360..1124085 | + | 726 | WP_121584942.1 | GNAT family N-acetyltransferase | - |
| EL296_RS05510 | 1124420..1124749 | - | 330 | WP_057064441.1 | TA system toxin CbtA family protein | Toxin |
| EL296_RS05515 | 1124770..1125087 | - | 318 | WP_007870247.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL296_RS05520 | 1125105..1125326 | - | 222 | WP_001548165.1 | DUF987 domain-containing protein | - |
| EL296_RS05525 | 1125335..1125811 | - | 477 | WP_057064440.1 | RadC family protein | - |
| EL296_RS05530 | 1125827..1126306 | - | 480 | WP_081014411.1 | antirestriction protein | - |
| EL296_RS05535 | 1127160..1129355 | - | 2196 | WP_124021032.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1121663..1162814 | 41151 | |
| - | inside | Genomic island | - | - | 1121663..1161514 | 39851 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12424.59 Da Isoelectric Point: 10.1006
>T287932 WP_057064441.1 NZ_LR134485:c1124749-1124420 [Citrobacter youngae]
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFWDQTVIKEHIDAGITLADAVNFLVDKYELVRIDRKGF
SWQEQTPYLSVVDILRARRSTGLLKAKVK
MKTLPATISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFWDQTVIKEHIDAGITLADAVNFLVDKYELVRIDRKGF
SWQEQTPYLSVVDILRARRSTGLLKAKVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|