Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpA-brnA/BrnT_toxin-BrnA |
Location | 2382950..2383481 | Replicon | chromosome |
Accession | NZ_LR134480 | ||
Organism | Bordetella bronchiseptica strain NCTC8344 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | K0MH61 |
Locus tag | EL399_RS11250 | Protein ID | WP_003812626.1 |
Coordinates | 2382950..2383216 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | K0MF02 |
Locus tag | EL399_RS11255 | Protein ID | WP_003816743.1 |
Coordinates | 2383203..2383481 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL399_RS11225 | 2378077..2378349 | + | 273 | WP_003812615.1 | hypothetical protein | - |
EL399_RS11230 | 2378388..2379098 | - | 711 | WP_003812617.1 | aquaporin Z | - |
EL399_RS11235 | 2379209..2379841 | - | 633 | WP_003812619.1 | PAS domain-containing protein | - |
EL399_RS11240 | 2380238..2381116 | + | 879 | WP_033450228.1 | tripartite tricarboxylate transporter substrate binding protein | - |
EL399_RS11245 | 2381178..2382719 | + | 1542 | WP_010928296.1 | M81 family metallopeptidase | - |
EL399_RS11250 | 2382950..2383216 | + | 267 | WP_003812626.1 | BrnT family toxin | Toxin |
EL399_RS11255 | 2383203..2383481 | + | 279 | WP_003816743.1 | BrnA antitoxin family protein | Antitoxin |
EL399_RS11265 | 2383803..2384459 | - | 657 | WP_033456960.1 | phosphoribosylanthranilate isomerase | - |
EL399_RS11270 | 2384474..2386141 | - | 1668 | WP_003812634.1 | TRAP transporter large permease subunit | - |
EL399_RS11275 | 2386144..2386773 | - | 630 | WP_003812635.1 | TRAP transporter small permease subunit | - |
EL399_RS11280 | 2386985..2388079 | - | 1095 | WP_003812637.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10037.47 Da Isoelectric Point: 7.9923
>T287926 WP_003812626.1 NZ_LR134480:2382950-2383216 [Bordetella bronchiseptica]
MDITYDPAKNDKNIADRGLSFELVCGFEWASALVVEDTRQVYAETRYQALGKIDGRLHMVVFTVRGESLRIISLRKANAR
EVARYEKA
MDITYDPAKNDKNIADRGLSFELVCGFEWASALVVEDTRQVYAETRYQALGKIDGRLHMVVFTVRGESLRIISLRKANAR
EVARYEKA
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|