Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 2085908..2086569 | Replicon | chromosome |
Accession | NZ_LR134480 | ||
Organism | Bordetella bronchiseptica strain NCTC8344 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q7WAH5 |
Locus tag | EL399_RS09885 | Protein ID | WP_003812073.1 |
Coordinates | 2086144..2086569 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL399_RS09880 | Protein ID | WP_003812071.1 |
Coordinates | 2085908..2086147 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL399_RS09845 | 2080943..2081746 | - | 804 | WP_003812055.1 | bacteriocin family protein | - |
EL399_RS09850 | 2081743..2082789 | - | 1047 | WP_003812057.1 | Dyp-type peroxidase | - |
EL399_RS09855 | 2082867..2083427 | - | 561 | WP_010926528.1 | DUF488 domain-containing protein | - |
EL399_RS09860 | 2083424..2083657 | - | 234 | WP_033447224.1 | DUF2945 domain-containing protein | - |
EL399_RS09865 | 2083738..2084250 | - | 513 | WP_033474080.1 | redoxin domain-containing protein | - |
EL399_RS09870 | 2084309..2084854 | - | 546 | WP_033452198.1 | peroxidase-related enzyme | - |
EL399_RS09875 | 2084992..2085834 | + | 843 | WP_033474079.1 | AraC family transcriptional regulator | - |
EL399_RS09880 | 2085908..2086147 | + | 240 | WP_003812071.1 | Arc family DNA-binding protein | Antitoxin |
EL399_RS09885 | 2086144..2086569 | + | 426 | WP_003812073.1 | PIN domain-containing protein | Toxin |
EL399_RS09890 | 2086679..2087143 | + | 465 | WP_003812075.1 | MarR family transcriptional regulator | - |
EL399_RS09895 | 2087249..2088754 | - | 1506 | WP_003812078.1 | tripartite tricarboxylate transporter permease | - |
EL399_RS09900 | 2089253..2089765 | + | 513 | WP_110124032.1 | hypothetical protein | - |
EL399_RS09905 | 2089786..2090763 | - | 978 | WP_003812083.1 | tripartite tricarboxylate transporter substrate binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 14811.22 Da Isoelectric Point: 6.3704
>T287925 WP_003812073.1 NZ_LR134480:2086144-2086569 [Bordetella bronchiseptica]
MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQLGLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDT
AAADAYAAVMMRAAAAGHALCAIDGCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA
MILLDTDVLLEPLRPAPDPAVAAWLDAQHVETLYLAAPGAAEIQLGLARLPRGKRAEALRHEFERRVLPLFMGHVLPFDT
AAADAYAAVMMRAAAAGHALCAIDGCIAAIATAHGLAIATRHPARFEAAGLAAVDPWHAAA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|