Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 4726575..4727097 | Replicon | chromosome |
Accession | NZ_LR134478 | ||
Organism | Serratia plymuthica strain NCTC8015 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A1B1KX47 |
Locus tag | EL316_RS22605 | Protein ID | WP_006317109.1 |
Coordinates | 4726575..4726856 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | EL316_RS22610 | Protein ID | WP_119805097.1 |
Coordinates | 4726846..4727097 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL316_RS22575 | 4721841..4722566 | + | 726 | WP_006317106.1 | LPS export ABC transporter ATP-binding protein | - |
EL316_RS22580 | 4722617..4724050 | + | 1434 | WP_006317107.1 | RNA polymerase factor sigma-54 | - |
EL316_RS22585 | 4724074..4724361 | + | 288 | WP_126485505.1 | ribosome hibernation promoting factor | - |
EL316_RS22590 | 4724644..4725105 | + | 462 | WP_004948550.1 | PTS IIA-like nitrogen regulatory protein PtsN | - |
EL316_RS22595 | 4725360..4726214 | + | 855 | WP_004948553.1 | RNase adapter RapZ | - |
EL316_RS22600 | 4726211..4726483 | + | 273 | WP_004948556.1 | PTS phosphocarrier protein NPr | - |
EL316_RS22605 | 4726575..4726856 | - | 282 | WP_006317109.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL316_RS22610 | 4726846..4727097 | - | 252 | WP_119805097.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
EL316_RS22615 | 4727204..4729120 | - | 1917 | WP_126485507.1 | BglG family transcription antiterminator | - |
EL316_RS22620 | 4729173..4730387 | - | 1215 | WP_126528817.1 | lactonase family protein | - |
EL316_RS22625 | 4730535..4731275 | - | 741 | WP_126485511.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10853.63 Da Isoelectric Point: 10.6974
>T287920 WP_006317109.1 NZ_LR134478:c4726856-4726575 [Serratia plymuthica]
MSYNLKFEKRALKEWQKLGHPIREQLKKKLAERLENPHVPASRLSGRSNRYKIKLRSSGYRLVYEVNDTEVILLVIAVGK
RAGDEVYSIADKR
MSYNLKFEKRALKEWQKLGHPIREQLKKKLAERLENPHVPASRLSGRSNRYKIKLRSSGYRLVYEVNDTEVILLVIAVGK
RAGDEVYSIADKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|