Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4315046..4315715 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | EL316_RS20655 | Protein ID | WP_126485007.1 |
| Coordinates | 4315046..4315468 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | EL316_RS20660 | Protein ID | WP_126485009.1 |
| Coordinates | 4315449..4315715 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS20635 | 4310068..4311431 | + | 1364 | WP_126483961.1 | IS3 family transposase | - |
| EL316_RS20640 | 4311487..4312851 | - | 1365 | WP_126485003.1 | cell envelope integrity protein CreD | - |
| EL316_RS20645 | 4312936..4314354 | - | 1419 | WP_126528687.1 | two-component system sensor histidine kinase CreC | - |
| EL316_RS20650 | 4314351..4315046 | - | 696 | WP_126528688.1 | two-component system response regulator CreB | - |
| EL316_RS20655 | 4315046..4315468 | - | 423 | WP_126485007.1 | protein YgfX | Toxin |
| EL316_RS20660 | 4315449..4315715 | - | 267 | WP_126485009.1 | FAD assembly factor SdhE | Antitoxin |
| EL316_RS20665 | 4316040..4317032 | + | 993 | WP_126485011.1 | tRNA-modifying protein YgfZ | - |
| EL316_RS20670 | 4317118..4317795 | - | 678 | WP_126485013.1 | hemolysin III family protein | - |
| EL316_RS20675 | 4317985..4318593 | + | 609 | WP_126485015.1 | HD domain-containing protein | - |
| EL316_RS20680 | 4318635..4319570 | - | 936 | WP_126485017.1 | ribokinase | - |
| EL316_RS20685 | 4319567..4320475 | - | 909 | WP_172603410.1 | allose kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16442.46 Da Isoelectric Point: 10.4481
>T287918 WP_126485007.1 NZ_LR134478:c4315468-4315046 [Serratia plymuthica]
VAQWRCNVRISWRTQLLSLLTHGVLILLILIAPWPEGYGPIWLVMLTLVVFECIRSQKRIASLQGELRLLANKRLSWHGQ
EWLLVKQPWMPRYGILLTLQPIQGKKPRRLWLASDSMGKAEWRHLRQLLQYPSADDDEEP
VAQWRCNVRISWRTQLLSLLTHGVLILLILIAPWPEGYGPIWLVMLTLVVFECIRSQKRIASLQGELRLLANKRLSWHGQ
EWLLVKQPWMPRYGILLTLQPIQGKKPRRLWLASDSMGKAEWRHLRQLLQYPSADDDEEP
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|