Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3940408..3941063 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL316_RS18910 | Protein ID | WP_126484530.1 |
| Coordinates | 3940408..3940797 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | EL316_RS18915 | Protein ID | WP_126484532.1 |
| Coordinates | 3940800..3941063 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS18895 | 3936885..3938318 | + | 1434 | WP_172603373.1 | MFS transporter | - |
| EL316_RS18900 | 3938315..3939697 | + | 1383 | WP_126484528.1 | two-component system sensor histidine kinase BaeS | - |
| EL316_RS18905 | 3939697..3940413 | + | 717 | WP_004951961.1 | two-component system response regulator BaeR | - |
| EL316_RS18910 | 3940408..3940797 | - | 390 | WP_126484530.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EL316_RS18915 | 3940800..3941063 | - | 264 | WP_126484532.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EL316_RS18920 | 3941414..3941752 | + | 339 | WP_126484534.1 | YegP family protein | - |
| EL316_RS18925 | 3942055..3943407 | + | 1353 | WP_126528572.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
| EL316_RS18930 | 3943900..3944799 | + | 900 | WP_126528573.1 | lipid kinase YegS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14058.40 Da Isoelectric Point: 7.8817
>T287915 WP_126484530.1 NZ_LR134478:c3940797-3940408 [Serratia plymuthica]
MYMFDTNTVSHLFRRHPGLLSAMEKVPPSTVCISSITEAELLFGVAKRQSKALKAMVTAFLAAVTVYDWDSEAARCYGVM
RASMEKKGKVLGALDQLIAAHALSRGATMVTSDRAFGMVPGLDVEDWTL
MYMFDTNTVSHLFRRHPGLLSAMEKVPPSTVCISSITEAELLFGVAKRQSKALKAMVTAFLAAVTVYDWDSEAARCYGVM
RASMEKKGKVLGALDQLIAAHALSRGATMVTSDRAFGMVPGLDVEDWTL
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|