Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 3904309..3904776 Replicon chromosome
Accession NZ_LR134478
Organism Serratia plymuthica strain NCTC8015

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag EL316_RS18770 Protein ID WP_126484494.1
Coordinates 3904309..3904578 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag EL316_RS18775 Protein ID WP_126484496.1
Coordinates 3904582..3904776 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL316_RS18740 3899353..3899868 + 516 WP_126484492.1 E3 ubiquitin--protein ligase -
EL316_RS18745 3899907..3900155 + 249 WP_004951888.1 GlsB/YeaQ/YmgE family stress response membrane protein -
EL316_RS18750 3900205..3901485 - 1281 WP_126528561.1 uracil permease -
EL316_RS18755 3901690..3902316 - 627 WP_006316899.1 uracil phosphoribosyltransferase -
EL316_RS18760 3902580..3903617 + 1038 WP_006316901.1 phosphoribosylformylglycinamidine cyclo-ligase -
EL316_RS18765 3903617..3904255 + 639 WP_013814081.1 phosphoribosylglycinamide formyltransferase -
EL316_RS18770 3904309..3904578 - 270 WP_126484494.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL316_RS18775 3904582..3904776 - 195 WP_126484496.1 hypothetical protein Antitoxin
EL316_RS18780 3904923..3905474 + 552 WP_126484498.1 spermidine N1-acetyltransferase -
EL316_RS18785 3905889..3906476 + 588 WP_126484500.1 helix-turn-helix domain-containing protein -
EL316_RS18790 3906473..3907285 + 813 WP_126484502.1 queuosine precursor transporter -
EL316_RS18795 3907414..3908240 - 827 Protein_3623 IS256 family transposase -
EL316_RS18800 3908265..3909077 - 813 WP_006316912.1 phosphate ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3900205..3912929 12724


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10585.20 Da        Isoelectric Point: 6.4810

>T287914 WP_126484494.1 NZ_LR134478:c3904578-3904309 [Serratia plymuthica]
MRIEWSREAQEELWNIIDYIDDRNPQAALILQRGIETAVHSLSLNLFMYRLGRVDNTREIVVHPNYLIVYRIIGHIEVLS
VIHAKREYP

Download         Length: 270 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7429.62 Da        Isoelectric Point: 10.2045

>AT287914 WP_126484496.1 NZ_LR134478:c3904776-3904582 [Serratia plymuthica]
MVIKTSLSTQPIAEVAEQGESYDRWFRAKIEAATNSEKPRVPHEQVMNEMQIRLAAKKKIRKME

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References