Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3169894..3170537 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | EL316_RS15380 | Protein ID | WP_126483534.1 |
| Coordinates | 3169894..3170310 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | EL316_RS15385 | Protein ID | WP_126483536.1 |
| Coordinates | 3170307..3170537 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS15350 | 3165529..3165690 | + | 162 | Protein_2958 | IS1 family transposase | - |
| EL316_RS15355 | 3166273..3166515 | + | 243 | WP_126483528.1 | acyl carrier protein | - |
| EL316_RS15360 | 3166750..3166995 | + | 246 | WP_126483530.1 | transposase | - |
| EL316_RS15365 | 3167050..3167364 | - | 315 | Protein_2961 | IS30 family transposase | - |
| EL316_RS15380 | 3169894..3170310 | - | 417 | WP_126483534.1 | PIN domain-containing protein | Toxin |
| EL316_RS15385 | 3170307..3170537 | - | 231 | WP_126483536.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EL316_RS15390 | 3171403..3171615 | + | 213 | WP_126483538.1 | hypothetical protein | - |
| EL316_RS15395 | 3171959..3173803 | - | 1845 | WP_126528294.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 3162909..3175817 | 12908 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15014.31 Da Isoelectric Point: 8.5226
>T287913 WP_126483534.1 NZ_LR134478:c3170310-3169894 [Serratia plymuthica]
VNKTYMLDTNICSFIMREQPEAVIKRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHAQLVDAFCTRLDAVLAWDRA
AVDATTEIKAALAAAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLKQEDWVK
VNKTYMLDTNICSFIMREQPEAVIKRLEQAVLRNHRIVVSAITYAEMRFGAIGKKASPRHAQLVDAFCTRLDAVLAWDRA
AVDATTEIKAALAAAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLKQEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|