Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3131321..3131952 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL316_RS15170 | Protein ID | WP_126528283.1 |
| Coordinates | 3131321..3131719 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | EL316_RS15175 | Protein ID | WP_126483484.1 |
| Coordinates | 3131719..3131952 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS15145 | 3126839..3127225 | + | 387 | WP_197718809.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EL316_RS15150 | 3127206..3127508 | + | 303 | WP_126483474.1 | transcriptional regulator | - |
| EL316_RS15155 | 3127566..3127970 | - | 405 | WP_126483476.1 | flagellar protein FlhE | - |
| EL316_RS15160 | 3127970..3130048 | - | 2079 | WP_126483478.1 | flagellar biosynthesis protein FlhA | - |
| EL316_RS15165 | 3130041..3131192 | - | 1152 | WP_126528282.1 | flagellar type III secretion system protein FlhB | - |
| EL316_RS15170 | 3131321..3131719 | - | 399 | WP_126528283.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EL316_RS15175 | 3131719..3131952 | - | 234 | WP_126483484.1 | antitoxin | Antitoxin |
| EL316_RS15180 | 3132076..3132720 | - | 645 | WP_126483486.1 | protein phosphatase CheZ | - |
| EL316_RS15185 | 3132731..3133120 | - | 390 | WP_006321484.1 | chemotaxis response regulator CheY | - |
| EL316_RS15190 | 3133341..3134390 | - | 1050 | WP_126483488.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| EL316_RS15195 | 3134390..3135262 | - | 873 | WP_126483490.1 | protein-glutamate O-methyltransferase CheR | - |
| EL316_RS15200 | 3135291..3136916 | - | 1626 | WP_126528284.1 | Tar ligand binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14871.02 Da Isoelectric Point: 7.5219
>T287912 WP_126528283.1 NZ_LR134478:c3131719-3131321 [Serratia plymuthica]
MFSHMLDTNIVIYVIKRRPIEVLSKFNQHAGKMVISSVTYAELIHGVEKSARPTENARVVDDFVSRLEILDYSAKAAAHY
GNIRASLEQQGTPMGVNDLHIAGHARSEGLVLVTNNLREFERVDGLRLQNWL
MFSHMLDTNIVIYVIKRRPIEVLSKFNQHAGKMVISSVTYAELIHGVEKSARPTENARVVDDFVSRLEILDYSAKAAAHY
GNIRASLEQQGTPMGVNDLHIAGHARSEGLVLVTNNLREFERVDGLRLQNWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|