Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3090594..3091219 | Replicon | chromosome |
Accession | NZ_LR134478 | ||
Organism | Serratia plymuthica strain NCTC8015 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | EL316_RS14925 | Protein ID | WP_006321377.1 |
Coordinates | 3090594..3090776 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | EL316_RS14930 | Protein ID | WP_126528271.1 |
Coordinates | 3090806..3091219 (+) | Length | 138 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL316_RS14920 | 3086456..3090427 | + | 3972 | WP_126528270.1 | trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase | - |
EL316_RS14925 | 3090594..3090776 | + | 183 | WP_006321377.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EL316_RS14930 | 3090806..3091219 | + | 414 | WP_126528271.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EL316_RS14935 | 3091252..3092004 | - | 753 | WP_062871168.1 | L-cystine ABC transporter ATP-binding protein YecC | - |
EL316_RS14940 | 3092008..3092670 | - | 663 | WP_006321381.1 | cystine ABC transporter permease | - |
EL316_RS14945 | 3092670..3093470 | - | 801 | WP_126483416.1 | cystine ABC transporter substrate-binding protein | - |
EL316_RS14950 | 3093585..3094577 | - | 993 | WP_126528272.1 | D-cysteine desulfhydrase | - |
EL316_RS14955 | 3094703..3095212 | - | 510 | WP_126483420.1 | flagella biosynthesis regulatory protein FliZ | - |
EL316_RS14960 | 3095269..3095991 | - | 723 | WP_126483422.1 | RNA polymerase sigma factor FliA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7004.29 Da Isoelectric Point: 11.5336
>T287911 WP_006321377.1 NZ_LR134478:3090594-3090776 [Serratia plymuthica]
VKSAELIRLLEREGWVLERIKGSHHQFKHPRSRLVITVPHPRKDLKPGTLRQIMRDAGLC
VKSAELIRLLEREGWVLERIKGSHHQFKHPRSRLVITVPHPRKDLKPGTLRQIMRDAGLC
Download Length: 183 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15046.78 Da Isoelectric Point: 4.8469
>AT287911 WP_126528271.1 NZ_LR134478:3090806-3091219 [Serratia plymuthica]
MFYPAYVHSDHDGSASGFFPDVPGCYFAGDTLDIAFEDAKSALDAHFELLSEDNQVIPRPQAVSFHLAQASDTLNGGQWL
LVDINMDKFDGRAERINITLPHRLLNRIDSLVQQHPGYGSRSAFLAAAARNELLKAG
MFYPAYVHSDHDGSASGFFPDVPGCYFAGDTLDIAFEDAKSALDAHFELLSEDNQVIPRPQAVSFHLAQASDTLNGGQWL
LVDINMDKFDGRAERINITLPHRLLNRIDSLVQQHPGYGSRSAFLAAAARNELLKAG
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|