Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 1846589..1847353 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | EL316_RS08890 | Protein ID | WP_126527814.1 |
| Coordinates | 1846589..1846957 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | EL316_RS08895 | Protein ID | WP_126527815.1 |
| Coordinates | 1847018..1847353 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS08850 | 1841801..1841994 | + | 194 | Protein_1693 | hypothetical protein | - |
| EL316_RS08855 | 1842404..1843372 | + | 969 | WP_126481714.1 | acyltransferase | - |
| EL316_RS08860 | 1843491..1843769 | + | 279 | WP_126527812.1 | acylphosphatase | - |
| EL316_RS08865 | 1843773..1844102 | - | 330 | WP_004942823.1 | sulfurtransferase TusE | - |
| EL316_RS08870 | 1844214..1844873 | - | 660 | WP_004942825.1 | FtsH protease modulator YccA | - |
| EL316_RS08880 | 1845332..1846165 | - | 834 | WP_126527813.1 | DUF4942 domain-containing protein | - |
| EL316_RS08890 | 1846589..1846957 | - | 369 | WP_126527814.1 | TA system toxin CbtA family protein | Toxin |
| EL316_RS08895 | 1847018..1847353 | - | 336 | WP_126527815.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL316_RS08900 | 1847370..1847849 | - | 480 | WP_126529012.1 | DNA repair protein RadC | - |
| EL316_RS08905 | 1847886..1848344 | - | 459 | WP_126527816.1 | antirestriction protein | - |
| EL316_RS08910 | 1848526..1849749 | - | 1224 | WP_172603401.1 | O-antigen ligase family protein | - |
| EL316_RS08915 | 1849835..1851004 | - | 1170 | WP_126527818.1 | putative lipopolysaccharide heptosyltransferase III | - |
| EL316_RS08920 | 1851607..1852083 | - | 477 | WP_126527819.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1828688..1856304 | 27616 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13902.05 Da Isoelectric Point: 8.2684
>T287906 WP_126527814.1 NZ_LR134478:c1846957-1846589 [Serratia plymuthica]
MKTSPFPPKREVYSCPSPVAIWRDLLTYLLAQHYGLTVNDTVFSDDTIIQEHIEAGISLADALNFIVEKFDLVRIDRRGF
SCREQSPFVTVIDILRARQACGLMSRRGYRAITQTILGDKRP
MKTSPFPPKREVYSCPSPVAIWRDLLTYLLAQHYGLTVNDTVFSDDTIIQEHIEAGISLADALNFIVEKFDLVRIDRRGF
SCREQSPFVTVIDILRARQACGLMSRRGYRAITQTILGDKRP
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|