Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 1706607..1707132 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | EL316_RS08265 | Protein ID | WP_062792950.1 |
| Coordinates | 1706607..1706891 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1B1KNT6 |
| Locus tag | EL316_RS08270 | Protein ID | WP_006320890.1 |
| Coordinates | 1706881..1707132 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS08240 | 1701871..1703004 | + | 1134 | WP_126481543.1 | putrescine ABC transporter ATP-binding subunit PotG | - |
| EL316_RS08245 | 1703035..1703988 | + | 954 | WP_126529010.1 | putrescine ABC transporter permease PotH | - |
| EL316_RS08250 | 1703985..1704830 | + | 846 | WP_006320894.1 | putrescine ABC transporter permease PotI | - |
| EL316_RS08255 | 1704933..1705412 | + | 480 | WP_126481545.1 | DUF2593 family protein | - |
| EL316_RS08260 | 1705483..1706610 | + | 1128 | WP_126527786.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
| EL316_RS08265 | 1706607..1706891 | - | 285 | WP_062792950.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL316_RS08270 | 1706881..1707132 | - | 252 | WP_006320890.1 | prevent-host-death protein | Antitoxin |
| EL316_RS08275 | 1707244..1707978 | - | 735 | WP_126481547.1 | arginine ABC transporter substrate-binding protein | - |
| EL316_RS08280 | 1708183..1708851 | - | 669 | WP_126527787.1 | arginine ABC transporter permease ArtM | - |
| EL316_RS08285 | 1708851..1709567 | - | 717 | WP_013812256.1 | arginine ABC transporter permease ArtQ | - |
| EL316_RS08290 | 1709577..1710308 | - | 732 | WP_013812257.1 | arginine ABC transporter substrate-binding protein | - |
| EL316_RS08295 | 1710342..1711070 | - | 729 | WP_126527788.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| EL316_RS08300 | 1711326..1711874 | - | 549 | WP_126481553.1 | lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10832.80 Da Isoelectric Point: 10.0293
>T287905 WP_062792950.1 NZ_LR134478:c1706891-1706607 [Serratia plymuthica]
MTYSLEFEEHALKEFKKLAPVLRDQFKKKLATVLENPCIPANRLSGLSDCYKIKLKASGYRLVYRVIDEEIVVLVLSIGK
RERSEAYTAAKKRL
MTYSLEFEEHALKEFKKLAPVLRDQFKKKLATVLENPCIPANRLSGLSDCYKIKLKASGYRLVYRVIDEEIVVLVLSIGK
RERSEAYTAAKKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|