Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 1577526..1578079 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | EL316_RS07675 | Protein ID | WP_119803676.1 |
| Coordinates | 1577771..1578079 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | - |
| Locus tag | EL316_RS07670 | Protein ID | WP_006322175.1 |
| Coordinates | 1577526..1577768 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS07655 | 1574014..1575552 | + | 1539 | WP_126527741.1 | glutathione ABC transporter substrate-binding protein GsiB | - |
| EL316_RS07660 | 1575605..1576525 | + | 921 | WP_126527742.1 | glutathione ABC transporter permease GsiC | - |
| EL316_RS07665 | 1576535..1577443 | + | 909 | WP_172603336.1 | glutathione ABC transporter permease GsiD | - |
| EL316_RS07670 | 1577526..1577768 | + | 243 | WP_006322175.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| EL316_RS07675 | 1577771..1578079 | + | 309 | WP_119803676.1 | CcdB family protein | Toxin |
| EL316_RS07680 | 1578116..1578958 | - | 843 | WP_126481398.1 | S-formylglutathione hydrolase | - |
| EL316_RS07685 | 1578973..1580100 | - | 1128 | WP_164713374.1 | S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | - |
| EL316_RS07690 | 1580129..1581046 | - | 918 | WP_126481400.1 | LysR family transcriptional regulator | - |
| EL316_RS07695 | 1581154..1582311 | + | 1158 | WP_126481402.1 | YbfB/YjiJ family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11533.40 Da Isoelectric Point: 5.0758
>T287904 WP_119803676.1 NZ_LR134478:1577771-1578079 [Serratia plymuthica]
MQFTVYDNIYPASAYPYLLDVQSDLIDVLSTRLMIPLYSLEKVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQIGEA
VGNANEHRNKIKAAIDFLIDGF
MQFTVYDNIYPASAYPYLLDVQSDLIDVLSTRLMIPLYSLEKVRVKISARLCPEIEVNGEKFLVMTHEMAAVRISQIGEA
VGNANEHRNKIKAAIDFLIDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|