Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1127181..1127803 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | S4YCZ4 |
| Locus tag | EL316_RS05390 | Protein ID | WP_006322256.1 |
| Coordinates | 1127181..1127384 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S4YKH5 |
| Locus tag | EL316_RS05395 | Protein ID | WP_004949348.1 |
| Coordinates | 1127435..1127803 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS05380 | 1122987..1124357 | + | 1371 | WP_126480739.1 | amidase | - |
| EL316_RS05385 | 1124405..1126345 | - | 1941 | WP_126527600.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| EL316_RS05390 | 1127181..1127384 | - | 204 | WP_006322256.1 | hemolysin expression modulator Hha | Toxin |
| EL316_RS05395 | 1127435..1127803 | - | 369 | WP_004949348.1 | Hha toxicity modulator TomB | Antitoxin |
| EL316_RS05400 | 1127964..1128290 | - | 327 | WP_126480745.1 | hypothetical protein | - |
| EL316_RS05410 | 1128769..1129482 | + | 714 | WP_126480749.1 | ABC transporter ATP-binding protein | - |
| EL316_RS05415 | 1129479..1130336 | + | 858 | WP_073439483.1 | metal ABC transporter permease | - |
| EL316_RS05420 | 1130362..1131240 | + | 879 | WP_126527601.1 | metal ABC transporter substrate-binding protein | - |
| EL316_RS05425 | 1131356..1131496 | - | 141 | WP_013811779.1 | type B 50S ribosomal protein L36 | - |
| EL316_RS05430 | 1131509..1131763 | - | 255 | WP_126480753.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8085.45 Da Isoelectric Point: 6.9764
>T287903 WP_006322256.1 NZ_LR134478:c1127384-1127181 [Serratia plymuthica]
MTKIDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPVAVWKFVR
MTKIDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPVAVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14203.92 Da Isoelectric Point: 4.5140
>AT287903 WP_004949348.1 NZ_LR134478:c1127803-1127435 [Serratia plymuthica]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEGICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEGICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B1KM53 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S4YKH5 |