Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
| Location | 928703..929259 | Replicon | chromosome |
| Accession | NZ_LR134478 | ||
| Organism | Serratia plymuthica strain NCTC8015 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | EL316_RS04375 | Protein ID | WP_126480465.1 |
| Coordinates | 928703..928993 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | EL316_RS04380 | Protein ID | WP_126480467.1 |
| Coordinates | 928981..929259 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL316_RS04355 | 923750..924700 | - | 951 | WP_126527534.1 | acetyltransferase | - |
| EL316_RS04360 | 924697..926442 | - | 1746 | WP_126480460.1 | IucA/IucC family siderophore biosynthesis protein | - |
| EL316_RS04365 | 926580..927803 | + | 1224 | WP_126480461.1 | MFS transporter | - |
| EL316_RS04370 | 927809..928693 | + | 885 | WP_126527535.1 | siderophore-interacting protein | - |
| EL316_RS04375 | 928703..928993 | - | 291 | WP_126480465.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL316_RS04380 | 928981..929259 | - | 279 | WP_126480467.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| EL316_RS04385 | 929345..929731 | - | 387 | WP_126480469.1 | oxalurate catabolism protein HpxZ | - |
| EL316_RS04390 | 929735..931135 | - | 1401 | WP_126480471.1 | AtzE family amidohydrolase | - |
| EL316_RS04395 | 931132..931323 | - | 192 | WP_126480473.1 | oxalurate catabolism protein HpxX | - |
| EL316_RS04400 | 931348..932934 | - | 1587 | WP_126480475.1 | gamma-glutamyltransferase family protein | - |
| EL316_RS04405 | 933079..933918 | + | 840 | WP_126480477.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10920.65 Da Isoelectric Point: 10.1818
>T287902 WP_126480465.1 NZ_LR134478:c928993-928703 [Serratia plymuthica]
VPQLIWTPAALLDVQRLYRFLAEKDLNSAKRAVATIRNSIKIIAHQPHIGRPAKDMAPEFREWPVDFGNSGYLVMYRFNG
VTAVILAIRHQSETGY
VPQLIWTPAALLDVQRLYRFLAEKDLNSAKRAVATIRNSIKIIAHQPHIGRPAKDMAPEFREWPVDFGNSGYLVMYRFNG
VTAVILAIRHQSETGY
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|