Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3958640..3959259 | Replicon | chromosome |
| Accession | NZ_LR134475 | ||
| Organism | Klebsiella aerogenes strain NCTC9735 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A0H3FXE2 |
| Locus tag | EL280_RS19345 | Protein ID | WP_015367918.1 |
| Coordinates | 3959041..3959259 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A0H3FPM3 |
| Locus tag | EL280_RS19340 | Protein ID | WP_015367917.1 |
| Coordinates | 3958640..3959014 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL280_RS19330 | 3953798..3954997 | + | 1200 | WP_020079451.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL280_RS19335 | 3955020..3958166 | + | 3147 | WP_015367916.1 | multidrug efflux RND transporter permease subunit | - |
| EL280_RS19340 | 3958640..3959014 | + | 375 | WP_015367917.1 | Hha toxicity modulator TomB | Antitoxin |
| EL280_RS19345 | 3959041..3959259 | + | 219 | WP_015367918.1 | hemolysin expression modulator Hha | Toxin |
| EL280_RS19350 | 3959391..3959954 | + | 564 | WP_020079452.1 | maltose O-acetyltransferase | - |
| EL280_RS19360 | 3960080..3960544 | + | 465 | WP_015367920.1 | YlaC family protein | - |
| EL280_RS19365 | 3960519..3961973 | - | 1455 | WP_126338664.1 | PLP-dependent aminotransferase family protein | - |
| EL280_RS19370 | 3962076..3962786 | + | 711 | WP_126338313.1 | GNAT family N-acetyltransferase | - |
| EL280_RS19375 | 3962783..3962923 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| EL280_RS19380 | 3962926..3963186 | - | 261 | WP_015367923.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8569.96 Da Isoelectric Point: 9.4828
>T287897 WP_015367918.1 NZ_LR134475:3959041-3959259 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14464.21 Da Isoelectric Point: 4.9045
>AT287897 WP_015367917.1 NZ_LR134475:3958640-3959014 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FPM3 |