Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2652818..2653557 | Replicon | chromosome |
Accession | NZ_LR134475 | ||
Organism | Klebsiella aerogenes strain NCTC9735 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | EL280_RS12885 | Protein ID | WP_126337963.1 |
Coordinates | 2653072..2653557 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A0H3FSM9 |
Locus tag | EL280_RS12880 | Protein ID | WP_015705366.1 |
Coordinates | 2652818..2653084 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL280_RS12855 | 2648153..2648740 | + | 588 | WP_126337959.1 | hypothetical protein | - |
EL280_RS12860 | 2648737..2650056 | + | 1320 | WP_126337961.1 | sensor histidine kinase | - |
EL280_RS12865 | 2650056..2650673 | + | 618 | WP_020078884.1 | response regulator transcription factor | - |
EL280_RS12870 | 2650769..2651266 | + | 498 | WP_015705368.1 | heme-binding protein | - |
EL280_RS12875 | 2651310..2652545 | - | 1236 | WP_020078885.1 | MFS transporter | - |
EL280_RS12880 | 2652818..2653084 | + | 267 | WP_015705366.1 | DUF1778 domain-containing protein | Antitoxin |
EL280_RS12885 | 2653072..2653557 | + | 486 | WP_126337963.1 | GNAT family N-acetyltransferase | Toxin |
EL280_RS12890 | 2653629..2655245 | + | 1617 | WP_126337965.1 | FAD-NAD(P)-binding protein | - |
EL280_RS12895 | 2655364..2656464 | + | 1101 | WP_015366663.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
EL280_RS12900 | 2656521..2656679 | - | 159 | WP_002903230.1 | YqaE/Pmp3 family membrane protein | - |
EL280_RS12905 | 2656940..2658010 | + | 1071 | WP_047465487.1 | mannonate dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17649.30 Da Isoelectric Point: 8.5242
>T287896 WP_126337963.1 NZ_LR134475:2653072-2653557 [Klebsiella aerogenes]
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGMKNQAQGAARTFVVCKEDSHQVVGFYSLATGSVNHTEATGDLRRNM
PDPIPVIILARLAIDCAFHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
MGKISAPAPLSSHHQIAEFCCGETVLDQWLKQRGMKNQAQGAARTFVVCKEDSHQVVGFYSLATGSVNHTEATGDLRRNM
PDPIPVIILARLAIDCAFHGQGLGADLLHDALLRSYRVAENVGVRALMVHALTDSAKRFYLHHGFKASTTQERTLFLALP
K
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|