Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 835923..836580 | Replicon | chromosome |
| Accession | NZ_LR134475 | ||
| Organism | Klebsiella aerogenes strain NCTC9735 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0H3FM52 |
| Locus tag | EL280_RS04155 | Protein ID | WP_015369792.1 |
| Coordinates | 836170..836580 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A0H3FJK6 |
| Locus tag | EL280_RS04150 | Protein ID | WP_015369791.1 |
| Coordinates | 835923..836189 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL280_RS04125 | 831150..832583 | - | 1434 | WP_032712496.1 | 6-phospho-beta-glucosidase BglA | - |
| EL280_RS04130 | 832703..833431 | - | 729 | WP_045391997.1 | MurR/RpiR family transcriptional regulator | - |
| EL280_RS04135 | 833482..833793 | + | 312 | WP_046881935.1 | N(4)-acetylcytidine aminohydrolase | - |
| EL280_RS04140 | 833958..834617 | + | 660 | WP_047065377.1 | hemolysin III family protein | - |
| EL280_RS04145 | 834716..835699 | - | 984 | WP_015369790.1 | tRNA-modifying protein YgfZ | - |
| EL280_RS04150 | 835923..836189 | + | 267 | WP_015369791.1 | FAD assembly factor SdhE | Antitoxin |
| EL280_RS04155 | 836170..836580 | + | 411 | WP_015369792.1 | protein YgfX | Toxin |
| EL280_RS04160 | 836588..837109 | - | 522 | WP_015369793.1 | flavodoxin FldB | - |
| EL280_RS04165 | 837210..838106 | + | 897 | WP_015703420.1 | site-specific tyrosine recombinase XerD | - |
| EL280_RS04170 | 838129..838842 | + | 714 | WP_015369795.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EL280_RS04175 | 838848..840581 | + | 1734 | WP_063421698.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15887.69 Da Isoelectric Point: 10.0200
>T287891 WP_015369792.1 NZ_LR134475:836170-836580 [Klebsiella aerogenes]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FM52 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3FJK6 |