Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PHD(antitoxin) |
Location | 2811101..2811756 | Replicon | chromosome |
Accession | NZ_LR134442 | ||
Organism | Propionibacterium australiense strain NCTC13651 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL282_RS12465 | Protein ID | WP_119161305.1 |
Coordinates | 2811361..2811756 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL282_RS12460 | Protein ID | WP_119161306.1 |
Coordinates | 2811101..2811364 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL282_RS12440 | 2807807..2808496 | + | 690 | WP_197720593.1 | TetR/AcrR family transcriptional regulator | - |
EL282_RS12445 | 2808493..2809341 | + | 849 | WP_119161307.1 | ABC transporter ATP-binding protein | - |
EL282_RS12450 | 2809431..2810453 | + | 1023 | WP_197720594.1 | hypothetical protein | - |
EL282_RS12455 | 2810378..2810896 | + | 519 | WP_197720595.1 | hypothetical protein | - |
EL282_RS12460 | 2811101..2811364 | + | 264 | WP_119161306.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
EL282_RS12465 | 2811361..2811756 | + | 396 | WP_119161305.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL282_RS12470 | 2811794..2813041 | - | 1248 | WP_119161304.1 | MFS transporter | - |
EL282_RS12475 | 2813499..2814224 | - | 726 | WP_119161404.1 | TetR family transcriptional regulator | - |
EL282_RS12480 | 2814394..2815473 | - | 1080 | WP_119161303.1 | inositol-3-phosphate synthase | - |
EL282_RS12485 | 2815525..2816553 | - | 1029 | WP_119161302.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14254.31 Da Isoelectric Point: 4.5901
>T287886 WP_119161305.1 NZ_LR134442:2811361-2811756 [Propionibacterium australiense]
MTICYLDTSAALKLLIEEAESESLGSWLTGEVTDGMTLCSSFLLHVELHCAARRRHRLDEQAVASLLAGIELIDISREHL
LAAARDTTGLRAADAIHLAVALDVRSDLLLTYDQEMQNAAQQRALTVVAPV
MTICYLDTSAALKLLIEEAESESLGSWLTGEVTDGMTLCSSFLLHVELHCAARRRHRLDEQAVASLLAGIELIDISREHL
LAAARDTTGLRAADAIHLAVALDVRSDLLLTYDQEMQNAAQQRALTVVAPV
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|