Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
Location | 2658695..2659233 | Replicon | chromosome |
Accession | NZ_LR134442 | ||
Organism | Propionibacterium australiense strain NCTC13651 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL282_RS11770 | Protein ID | WP_119162610.1 |
Coordinates | 2658695..2658961 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | EL282_RS11775 | Protein ID | WP_119162609.1 |
Coordinates | 2658961..2659233 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL282_RS11755 | 2654972..2655898 | + | 927 | WP_119162613.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
EL282_RS11760 | 2656171..2657619 | + | 1449 | WP_119162612.1 | amino acid permease | - |
EL282_RS11765 | 2657623..2658615 | + | 993 | WP_119162611.1 | asparaginase | - |
EL282_RS11770 | 2658695..2658961 | - | 267 | WP_119162610.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL282_RS11775 | 2658961..2659233 | - | 273 | WP_119162609.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
EL282_RS11780 | 2659365..2660012 | - | 648 | WP_119162608.1 | class II aldolase/adducin family protein | - |
EL282_RS11785 | 2660028..2661947 | - | 1920 | WP_119162607.1 | PTS sugar transporter subunit IIA | - |
EL282_RS11790 | 2662207..2663265 | + | 1059 | WP_119162606.1 | alcohol dehydrogenase catalytic domain-containing protein | - |
EL282_RS11795 | 2663270..2663569 | + | 300 | WP_119162605.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10010.70 Da Isoelectric Point: 11.0068
>T287885 WP_119162610.1 NZ_LR134442:c2658961-2658695 [Propionibacterium australiense]
MAWTLRFSSDFERSLHKLDRQTARRILVKLHGLVSLDEPQARCKGLAGPLAGLWRLRVGDYRVLLDIRRAELVIVALGVG
HRSSIYDT
MAWTLRFSSDFERSLHKLDRQTARRILVKLHGLVSLDEPQARCKGLAGPLAGLWRLRVGDYRVLLDIRRAELVIVALGVG
HRSSIYDT
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|