Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2093794..2094346 | Replicon | chromosome |
Accession | NZ_LR134442 | ||
Organism | Propionibacterium australiense strain NCTC13651 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | EL282_RS09245 | Protein ID | WP_119161073.1 |
Coordinates | 2093794..2094111 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | EL282_RS09250 | Protein ID | WP_119161072.1 |
Coordinates | 2094113..2094346 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL282_RS09230 | 2089100..2092144 | - | 3045 | WP_119161075.1 | excinuclease ABC subunit UvrA | - |
EL282_RS09235 | 2092431..2093180 | + | 750 | WP_119161074.1 | maleylpyruvate isomerase family mycothiol-dependent enzyme | - |
EL282_RS09240 | 2093183..2093779 | + | 597 | WP_119161143.1 | MBL fold metallo-hydrolase | - |
EL282_RS09245 | 2093794..2094111 | - | 318 | WP_119161073.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL282_RS09250 | 2094113..2094346 | - | 234 | WP_119161072.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
EL282_RS09255 | 2094434..2095483 | - | 1050 | WP_119161071.1 | TerC/Alx family metal homeostasis membrane protein | - |
EL282_RS09260 | 2095711..2097789 | - | 2079 | WP_119161070.1 | excinuclease ABC subunit UvrB | - |
EL282_RS09265 | 2097872..2098534 | + | 663 | WP_126464245.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11259.99 Da Isoelectric Point: 4.4678
>T287884 WP_119161073.1 NZ_LR134442:c2094111-2093794 [Propionibacterium australiense]
VREICLAEFDKTRPVLVLTRELAREAMTKVTVAPITSTVKGLSSELRLGPDNGLDHECAASLDNVVTIPVTSLGRTVGFL
GPDQERALAVAVVLAYDLQVSLLED
VREICLAEFDKTRPVLVLTRELAREAMTKVTVAPITSTVKGLSSELRLGPDNGLDHECAASLDNVVTIPVTSLGRTVGFL
GPDQERALAVAVVLAYDLQVSLLED
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|