Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1433467..1434080 | Replicon | chromosome |
Accession | NZ_LR134442 | ||
Organism | Propionibacterium australiense strain NCTC13651 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL282_RS06320 | Protein ID | WP_119160674.1 |
Coordinates | 1433697..1434080 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL282_RS06315 | Protein ID | WP_119160675.1 |
Coordinates | 1433467..1433697 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL282_RS06300 | 1430340..1431908 | + | 1569 | WP_119160678.1 | sodium-dependent transporter | - |
EL282_RS06305 | 1431910..1432017 | + | 108 | WP_119160677.1 | MetS family NSS transporter small subunit | - |
EL282_RS06310 | 1432130..1433227 | - | 1098 | WP_119160676.1 | DUF418 domain-containing protein | - |
EL282_RS06315 | 1433467..1433697 | + | 231 | WP_119160675.1 | toxin-antitoxin system, antitoxin component | Antitoxin |
EL282_RS06320 | 1433697..1434080 | + | 384 | WP_119160674.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL282_RS06325 | 1434184..1434987 | + | 804 | WP_119160673.1 | MerR family transcriptional regulator | - |
EL282_RS06330 | 1435161..1435400 | - | 240 | WP_119160672.1 | type B 50S ribosomal protein L31 | - |
EL282_RS06335 | 1435470..1435706 | + | 237 | WP_119160671.1 | 50S ribosomal protein L28 | - |
EL282_RS06340 | 1435706..1435879 | + | 174 | WP_119160670.1 | 50S ribosomal protein L33 | - |
EL282_RS06345 | 1436014..1436913 | - | 900 | WP_119160669.1 | family 1 glycosylhydrolase | - |
EL282_RS06350 | 1437065..1437829 | + | 765 | WP_197720667.1 | transposase | - |
EL282_RS06355 | 1437792..1438355 | - | 564 | WP_197720668.1 | glycoside hydrolase family 1 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13560.59 Da Isoelectric Point: 4.3711
>T287883 WP_119160674.1 NZ_LR134442:1433697-1434080 [Propionibacterium australiense]
MWVIDASAAAELLLGTTQGRAVAATIGDEDVYAPQLLAVEVVSVMRGMVRGGDITGTRAEAALHDFDDLGVIWVDMSPLI
SAAWALRDSASAHDAMYVALAERLECPLLTCDRRLAKTFTRCVVPQG
MWVIDASAAAELLLGTTQGRAVAATIGDEDVYAPQLLAVEVVSVMRGMVRGGDITGTRAEAALHDFDDLGVIWVDMSPLI
SAAWALRDSASAHDAMYVALAERLECPLLTCDRRLAKTFTRCVVPQG
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|