Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 10481..11157 | Replicon | chromosome |
Accession | NZ_LR134442 | ||
Organism | Propionibacterium australiense strain NCTC13651 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL282_RS00035 | Protein ID | WP_119162416.1 |
Coordinates | 10720..11157 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL282_RS00030 | Protein ID | WP_119162415.1 |
Coordinates | 10481..10714 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL282_RS00025 | 8270..9898 | - | 1629 | WP_119162414.1 | NAD(P)-binding protein | - |
EL282_RS00030 | 10481..10714 | + | 234 | WP_119162415.1 | DUF2191 domain-containing protein | Antitoxin |
EL282_RS00035 | 10720..11157 | + | 438 | WP_119162416.1 | VapC toxin family PIN domain ribonuclease | Toxin |
EL282_RS00040 | 11204..11512 | - | 309 | WP_119162417.1 | thiamine-binding protein | - |
EL282_RS00045 | 11652..12242 | + | 591 | WP_119162418.1 | DUF1440 domain-containing protein | - |
EL282_RS13755 | 12264..14078 | - | 1815 | WP_197720674.1 | thiol reductant ABC exporter subunit CydC | - |
EL282_RS13760 | 14055..15671 | - | 1617 | Protein_10 | thiol reductant ABC exporter subunit CydD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15990.32 Da Isoelectric Point: 5.7720
>T287879 WP_119162416.1 NZ_LR134442:10720-11157 [Propionibacterium australiense]
MTQHRTRLLDVNVVIALSLPSHVHHEIVTTWFEDVRDWATCPITQSAYVRLLLNQNVTGFRIAPGDVLAGMAALCAVDGH
EFLSDDAPLSEPLIDFSVLSGSKQVTDLHLVDLAARHRAVLATMDSRIPNALAPDDRRHVELIPV
MTQHRTRLLDVNVVIALSLPSHVHHEIVTTWFEDVRDWATCPITQSAYVRLLLNQNVTGFRIAPGDVLAGMAALCAVDGH
EFLSDDAPLSEPLIDFSVLSGSKQVTDLHLVDLAARHRAVLATMDSRIPNALAPDDRRHVELIPV
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|