Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 444813..445457 | Replicon | chromosome |
Accession | NZ_LR134440 | ||
Organism | Neisseria animaloris strain NCTC12228 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL216_RS02120 | Protein ID | WP_085360419.1 |
Coordinates | 445062..445457 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL216_RS02115 | Protein ID | WP_085389826.1 |
Coordinates | 444813..445058 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL216_RS02095 | 440357..441367 | + | 1011 | WP_085389823.1 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | - |
EL216_RS02100 | 441463..442620 | - | 1158 | WP_085389824.1 | alpha-hydroxy-acid oxidizing protein | - |
EL216_RS02105 | 443015..443458 | + | 444 | WP_054600297.1 | Fe-S cluster assembly transcriptional regulator IscR | - |
EL216_RS02110 | 443494..444708 | + | 1215 | WP_085389825.1 | IscS subfamily cysteine desulfurase | - |
EL216_RS02115 | 444813..445058 | + | 246 | WP_085389826.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL216_RS02120 | 445062..445457 | + | 396 | WP_085360419.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL216_RS02125 | 445584..445967 | + | 384 | WP_085360421.1 | Fe-S cluster assembly scaffold IscU | - |
EL216_RS02130 | 446027..446263 | + | 237 | WP_085389827.1 | recombinase RecA | - |
EL216_RS02135 | 446405..446725 | + | 321 | WP_054600303.1 | iron-sulfur cluster assembly protein IscA | - |
EL216_RS02140 | 446834..447370 | + | 537 | WP_085356722.1 | inorganic diphosphatase | - |
EL216_RS02145 | 447615..447968 | - | 354 | WP_085356721.1 | helix-turn-helix transcriptional regulator | - |
EL216_RS02150 | 448164..448400 | + | 237 | WP_085389828.1 | DUF896 domain-containing protein | - |
EL216_RS02155 | 448603..449478 | + | 876 | WP_085389829.1 | pirin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14444.70 Da Isoelectric Point: 7.5203
>T287877 WP_085360419.1 NZ_LR134440:445062-445457 [Neisseria animaloris]
MRYLLDTNIVSHILRRQPNVMAKLQSVPMSDLYISAVTHAELMYGLAKKPDAAKLHRAVHELLLRIGVLPFDEQASTHYG
KFKAQAEQSGKNLASLDMMIAAHASAVSAVLVSNDAAFQQIADLSVEDWTK
MRYLLDTNIVSHILRRQPNVMAKLQSVPMSDLYISAVTHAELMYGLAKKPDAAKLHRAVHELLLRIGVLPFDEQASTHYG
KFKAQAEQSGKNLASLDMMIAAHASAVSAVLVSNDAAFQQIADLSVEDWTK
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|