Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
| Location | 105878..106412 | Replicon | plasmid 9 |
| Accession | NZ_LR134418 | ||
| Organism | Legionella adelaidensis strain NCTC12735 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0W0R328 |
| Locus tag | EL206_RS01640 | Protein ID | WP_058461223.1 |
| Coordinates | 106131..106412 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | A0A0W0R313 |
| Locus tag | EL206_RS01635 | Protein ID | WP_058461224.1 |
| Coordinates | 105878..106144 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL206_RS01620 | 102550..102879 | - | 330 | WP_058461226.1 | ferredoxin family protein | - |
| EL206_RS01625 | 103073..105259 | + | 2187 | WP_058461225.1 | PAS domain S-box protein | - |
| EL206_RS01630 | 105313..105678 | + | 366 | WP_058462328.1 | response regulator | - |
| EL206_RS01635 | 105878..106144 | + | 267 | WP_058461224.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL206_RS01640 | 106131..106412 | + | 282 | WP_058461223.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| EL206_RS01660 | 107161..107724 | - | 564 | WP_058462327.1 | CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase | - |
| EL206_RS01665 | 107763..108419 | - | 657 | WP_058461222.1 | HAD-IA family hydrolase | - |
| EL206_RS01670 | 108412..109353 | - | 942 | WP_058461221.1 | RluA family pseudouridine synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | pilE / ankH/legA3/ankW / pilT / enhA / lpg2359 / lpg2370 / lirB | 1..451287 | 451287 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11106.73 Da Isoelectric Point: 9.7931
>T287872 WP_058461223.1 NZ_LR134418:106131-106412 [Legionella adelaidensis]
MRTIEYTTQFKRDYKREIKGKYKAVFSNLFIEIIDTLARDEPLAAKHRDHALSNNWQDHRDCHIKPDLVLIYRKPDRQTL
QLVRLGSHSELSL
MRTIEYTTQFKRDYKREIKGKYKAVFSNLFIEIIDTLARDEPLAAKHRDHALSNNWQDHRDCHIKPDLVLIYRKPDRQTL
QLVRLGSHSELSL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0W0R328 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0W0R313 |