Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3069198..3069857 | Replicon | chromosome |
Accession | NZ_LR134406 | ||
Organism | Arachnia propionica strain NCTC12967 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL272_RS13690 | Protein ID | WP_197720344.1 |
Coordinates | 3069198..3069533 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A448N254 |
Locus tag | EL272_RS13695 | Protein ID | WP_073970044.1 |
Coordinates | 3069609..3069857 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL272_RS13665 | 3064805..3065461 | - | 657 | WP_014847806.1 | response regulator transcription factor | - |
EL272_RS13670 | 3065455..3066642 | - | 1188 | WP_014847807.1 | sensor histidine kinase | - |
EL272_RS13675 | 3066772..3067494 | + | 723 | WP_061787614.1 | ATP-binding cassette domain-containing protein | - |
EL272_RS13680 | 3067491..3068273 | + | 783 | WP_061787613.1 | ABC transporter permease | - |
EL272_RS13685 | 3068420..3068932 | - | 513 | WP_061787612.1 | lincomycin resistance protein LmrB | - |
EL272_RS13690 | 3069198..3069533 | - | 336 | WP_197720344.1 | PIN domain-containing protein | Toxin |
EL272_RS13695 | 3069609..3069857 | - | 249 | WP_073970044.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
EL272_RS13700 | 3070126..3070365 | + | 240 | WP_061787610.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
EL272_RS13705 | 3070365..3070724 | + | 360 | WP_061787609.1 | type II toxin-antitoxin system VapC family toxin | - |
EL272_RS13710 | 3070963..3072918 | + | 1956 | WP_197720267.1 | type I restriction-modification system subunit M | - |
EL272_RS13715 | 3072915..3074144 | + | 1230 | WP_073970031.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12270.12 Da Isoelectric Point: 8.5406
>T287871 WP_197720344.1 NZ_LR134406:c3069533-3069198 [Arachnia propionica]
MTADEPFGVSELILSGFLRIVTNHRVYREPTSPQVALDFCQTVLSASSAVRIRPGRGHWRIFESLCRNLGARGNVVPDAY
LAAMAIEADATFITMDAGFARFPGLTWRRAL
MTADEPFGVSELILSGFLRIVTNHRVYREPTSPQVALDFCQTVLSASSAVRIRPGRGHWRIFESLCRNLGARGNVVPDAY
LAAMAIEADATFITMDAGFARFPGLTWRRAL
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|