Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2467814..2468457 Replicon chromosome
Accession NZ_LR134406
Organism Arachnia propionica strain NCTC12967

Toxin (Protein)


Gene name vapC Uniprot ID A0A448N0K5
Locus tag EL272_RS11020 Protein ID WP_061788423.1
Coordinates 2468056..2468457 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A448N0G6
Locus tag EL272_RS11015 Protein ID WP_061788424.1
Coordinates 2467814..2468059 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL272_RS10985 2463658..2464626 - 969 WP_061788426.1 WYL domain-containing protein -
EL272_RS10990 2464725..2465108 + 384 WP_061788425.1 VOC family protein -
EL272_RS10995 2465214..2466509 + 1296 WP_051015025.1 DUF4143 domain-containing protein -
EL272_RS11000 2466881..2467048 - 168 WP_014847286.1 50S ribosomal protein L33 -
EL272_RS11005 2467050..2467286 - 237 WP_014847287.1 50S ribosomal protein L28 -
EL272_RS11010 2467371..2467619 + 249 WP_041697718.1 type B 50S ribosomal protein L31 -
EL272_RS11015 2467814..2468059 + 246 WP_061788424.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
EL272_RS11020 2468056..2468457 + 402 WP_061788423.1 type II toxin-antitoxin system VapC family toxin Toxin
EL272_RS11025 2468543..2469241 - 699 WP_061788422.1 50S ribosomal protein L1 -
EL272_RS11030 2469325..2469753 - 429 WP_014847292.1 50S ribosomal protein L11 -
EL272_RS11035 2469850..2470635 - 786 WP_061788421.1 transcription termination/antitermination protein NusG -
EL272_RS11040 2470632..2471216 - 585 WP_081490305.1 preprotein translocase subunit SecE -
EL272_RS11050 2471353..2472375 - 1023 WP_061788420.1 UDP-N-acetylmuramate dehydrogenase -
EL272_RS11055 2472368..2472781 - 414 WP_014847296.1 MaoC family dehydratase -
EL272_RS11060 2472774..2473202 - 429 WP_061788419.1 MaoC family dehydratase N-terminal domain-containing protein -
EL272_RS11065 2473273..2473443 - 171 WP_014847298.1 50S ribosomal protein L33 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-124)

Antitoxin

Antitoxin VapB-like

(2-74)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 13933.99 Da        Isoelectric Point: 6.2177

>T287868 WP_061788423.1 NZ_LR134406:2468056-2468457 [Arachnia propionica]
MIVAPSAIAAILLKEPESSGFRELLGRRGGQLSAPGYLELSIVLTARGVTDPVATLDAILLGLGVEVVPFTPSQARLAQE
AHLRFGRGSGHPARLNFGDCISYALAKDTGEPLLFKGNDFVHTDLNPASGISP

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8777.81 Da        Isoelectric Point: 4.4651

>AT287868 WP_061788424.1 NZ_LR134406:2467814-2468059 [Arachnia propionica]
VSLNIKDEHIHDLVRRAATRTGLSQTRVVERAVVELLASLEAEAAASGLDQLLDRVHAELTASGGALDFDALYDPETELP
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A448N0K5

Antitoxin

Source ID Structure
AlphaFold DB A0A448N0G6

References