Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hipBA/HipA-HipB |
Location | 3857982..3859558 | Replicon | chromosome |
Accession | NZ_LR134396 | ||
Organism | Providencia rustigianii strain NCTC8113 |
Toxin (Protein)
Gene name | hipA | Uniprot ID | - |
Locus tag | EL244_RS17830 | Protein ID | WP_126462677.1 |
Coordinates | 3857982..3859301 (-) | Length | 440 a.a. |
Antitoxin (Protein)
Gene name | hipB | Uniprot ID | - |
Locus tag | EL244_RS17835 | Protein ID | WP_039855850.1 |
Coordinates | 3859301..3859558 (-) | Length | 86 a.a. |
Genomic Context
Location: 3857141..3857971 (831 bp)
Type: Others
Protein ID: WP_126462674.1
Type: Others
Protein ID: WP_126462674.1
Location: 3853918..3856965 (3048 bp)
Type: Others
Protein ID: WP_126462671.1
Type: Others
Protein ID: WP_126462671.1
Location: 3857982..3859301 (1320 bp)
Type: Toxin
Protein ID: WP_126462677.1
Type: Toxin
Protein ID: WP_126462677.1
Location: 3859301..3859558 (258 bp)
Type: Antitoxin
Protein ID: WP_039855850.1
Type: Antitoxin
Protein ID: WP_039855850.1
Location: 3859719..3861083 (1365 bp)
Type: Others
Protein ID: WP_126462681.1
Type: Others
Protein ID: WP_126462681.1
Location: 3861195..3862847 (1653 bp)
Type: Others
Protein ID: WP_006816153.1
Type: Others
Protein ID: WP_006816153.1
Location: 3862850..3863110 (261 bp)
Type: Others
Protein ID: WP_036959180.1
Type: Others
Protein ID: WP_036959180.1
Location: 3863074..3863433 (360 bp)
Type: Others
Protein ID: WP_006816151.1
Type: Others
Protein ID: WP_006816151.1
Location: 3863451..3863594 (144 bp)
Type: Others
Protein ID: WP_004906236.1
Type: Others
Protein ID: WP_004906236.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL244_RS17820 | 3853918..3856965 | - | 3048 | WP_126462671.1 | formate dehydrogenase-N subunit alpha | - |
EL244_RS17825 | 3857141..3857971 | + | 831 | WP_126462674.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
EL244_RS17830 | 3857982..3859301 | - | 1320 | WP_126462677.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
EL244_RS17835 | 3859301..3859558 | - | 258 | WP_039855850.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL244_RS17840 | 3859719..3861083 | - | 1365 | WP_126462681.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
EL244_RS17845 | 3861195..3862847 | - | 1653 | WP_006816153.1 | membrane protein insertase YidC | - |
EL244_RS17850 | 3862850..3863110 | - | 261 | WP_036959180.1 | membrane protein insertion efficiency factor YidD | - |
EL244_RS17855 | 3863074..3863433 | - | 360 | WP_006816151.1 | ribonuclease P protein component | - |
EL244_RS17860 | 3863451..3863594 | - | 144 | WP_004906236.1 | 50S ribosomal protein L34 | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 440 a.a. Molecular weight: 50279.64 Da Isoelectric Point: 6.8248
>T287865 WP_126462677.1 NZ_LR134396:c3859301-3857982 [Providencia rustigianii]
MATLYVYMNGYLVGEFIRSSTGAHQFKYDSHWLETPGARPISLSMPLQHQEYKGDEVYNFFDNLLPDNIEIRNRVVSRHQ
VDSNQPFDLLSKIGQDSVGALQLVPAEQTVSNVKQIEYKRLSTKKLEKILTGYRANIPLGMIDEVDDFRISIAGAQEKTA
LLNLDGHWYLPLNATPTTHIIKLPIGKIESHSYSIDLSESVENEYLCLLIAKEFGLDVPHSFILNIGEIKALVVEHFDRK
YSSDDTWIMRLPQEDFCQTLNVSPARKYQSHGGPGIQEIMDYLLGSINVEKDRYQFMKSQVLFWLLAATDGHAKNFSLFI
ESEGRYRLTPFYDILSMYPSYGGREIHPRDAKLAMGLKGKKGIKYEIEQIFPRHFFATAKAVGFARAEMEKILIEFDEKM
DSVIKKVRKQLPLDFPEHIANSILSGLHHKAERLKKGWD
MATLYVYMNGYLVGEFIRSSTGAHQFKYDSHWLETPGARPISLSMPLQHQEYKGDEVYNFFDNLLPDNIEIRNRVVSRHQ
VDSNQPFDLLSKIGQDSVGALQLVPAEQTVSNVKQIEYKRLSTKKLEKILTGYRANIPLGMIDEVDDFRISIAGAQEKTA
LLNLDGHWYLPLNATPTTHIIKLPIGKIESHSYSIDLSESVENEYLCLLIAKEFGLDVPHSFILNIGEIKALVVEHFDRK
YSSDDTWIMRLPQEDFCQTLNVSPARKYQSHGGPGIQEIMDYLLGSINVEKDRYQFMKSQVLFWLLAATDGHAKNFSLFI
ESEGRYRLTPFYDILSMYPSYGGREIHPRDAKLAMGLKGKKGIKYEIEQIFPRHFFATAKAVGFARAEMEKILIEFDEKM
DSVIKKVRKQLPLDFPEHIANSILSGLHHKAERLKKGWD
Download Length: 1320 bp