Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3615480..3616017 | Replicon | chromosome |
Accession | NZ_LR134396 | ||
Organism | Providencia rustigianii strain NCTC8113 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL244_RS16610 | Protein ID | WP_112837460.1 |
Coordinates | 3615480..3615773 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A379G845 |
Locus tag | EL244_RS16615 | Protein ID | WP_039854881.1 |
Coordinates | 3615763..3616017 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL244_RS16580 | 3611086..3612402 | - | 1317 | WP_126462384.1 | N-acetylmuramoyl-L-alanine amidase AmiB | - |
EL244_RS16585 | 3612417..3612881 | - | 465 | WP_006814566.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
EL244_RS16590 | 3613097..3614254 | + | 1158 | WP_126462387.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
EL244_RS16610 | 3615480..3615773 | - | 294 | WP_112837460.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL244_RS16615 | 3615763..3616017 | - | 255 | WP_039854881.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
EL244_RS16620 | 3616106..3616648 | - | 543 | WP_006814571.1 | oligoribonuclease | - |
EL244_RS16625 | 3616786..3617838 | + | 1053 | WP_006814572.1 | small ribosomal subunit biogenesis GTPase RsgA | - |
EL244_RS16630 | 3617982..3618872 | + | 891 | WP_006814573.1 | phosphatidylserine decarboxylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11286.16 Da Isoelectric Point: 10.4251
>T287863 WP_112837460.1 NZ_LR134396:c3615773-3615480 [Providencia rustigianii]
MIYSIEFDERALKEWKKLDSSIRDQFKNKLKKLQKNPHVESARLHGELSSCYKIKLRSSGYRLVYQVIHSEIVIFVIAIG
KREASTAYTAANTRLVK
MIYSIEFDERALKEWKKLDSSIRDQFKNKLKKLQKNPHVESARLHGELSSCYKIKLRSSGYRLVYQVIHSEIVIFVIAIG
KREASTAYTAANTRLVK
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|