Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2508745..2509400 | Replicon | chromosome |
| Accession | NZ_LR134396 | ||
| Organism | Providencia rustigianii strain NCTC8113 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL244_RS11580 | Protein ID | WP_071599550.1 |
| Coordinates | 2508745..2508930 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | D1P354 |
| Locus tag | EL244_RS11585 | Protein ID | WP_006814675.1 |
| Coordinates | 2508987..2509400 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL244_RS11560 | 2504658..2505746 | - | 1089 | WP_126461046.1 | sulfate/thiosulfate ABC transporter ATP-binding protein CysA | - |
| EL244_RS11565 | 2505749..2506609 | - | 861 | WP_126461049.1 | sulfate/thiosulfate ABC transporter permease CysW | - |
| EL244_RS11570 | 2506609..2507439 | - | 831 | WP_006814673.1 | sulfate/thiosulfate ABC transporter permease CysT | - |
| EL244_RS11575 | 2507439..2508461 | - | 1023 | WP_115164490.1 | sulfate ABC transporter substrate-binding protein | - |
| EL244_RS11580 | 2508745..2508930 | + | 186 | WP_071599550.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL244_RS11585 | 2508987..2509400 | + | 414 | WP_006814675.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL244_RS11590 | 2509458..2510354 | - | 897 | WP_006814676.1 | Dyp-type peroxidase | - |
| EL244_RS11595 | 2510569..2511153 | - | 585 | WP_039855044.1 | RpoE-regulated lipoprotein | - |
| EL244_RS11600 | 2511235..2511666 | - | 432 | WP_006814678.1 | GNAT family acetyltransferase | - |
| EL244_RS11605 | 2511802..2512719 | + | 918 | WP_006814679.1 | oxygen-dependent coproporphyrinogen oxidase | - |
| EL244_RS11610 | 2512877..2514010 | + | 1134 | WP_126461052.1 | M4 family metallopeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 7064.36 Da Isoelectric Point: 11.2336
>T287862 WP_071599550.1 NZ_LR134396:2508745-2508930 [Providencia rustigianii]
MKSSELIKLLEKNGWRLERIKGSHHQFSHPNFSIVITVPHPRKDLKIGTLNQILTVAKLKH
MKSSELIKLLEKNGWRLERIKGSHHQFSHPNFSIVITVPHPRKDLKIGTLNQILTVAKLKH
Download Length: 186 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15388.27 Da Isoelectric Point: 4.9767
>AT287862 WP_006814675.1 NZ_LR134396:2508987-2509400 [Providencia rustigianii]
MLYPAFIEIDSDGSASGWFPDIEGCTFAGDNIEDAYADAKSAIDVHFELLSEKGFKIPSPKSQHAHLQDTPDIYQKGIWL
LVDIDMDKYDGRAERVNITLPHRLLHRIDTLVKEHPEYGSRSGFIAAAARKELQKNS
MLYPAFIEIDSDGSASGWFPDIEGCTFAGDNIEDAYADAKSAIDVHFELLSEKGFKIPSPKSQHAHLQDTPDIYQKGIWL
LVDIDMDKYDGRAERVNITLPHRLLHRIDTLVKEHPEYGSRSGFIAAAARKELQKNS
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|