Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 1467916..1468615 | Replicon | chromosome |
Accession | NZ_LR134396 | ||
Organism | Providencia rustigianii strain NCTC8113 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | EL244_RS06550 | Protein ID | WP_126459605.1 |
Coordinates | 1467916..1468302 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D1NZL2 |
Locus tag | EL244_RS06555 | Protein ID | WP_006813433.1 |
Coordinates | 1468295..1468615 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL244_RS06530 | 1463138..1463764 | + | 627 | WP_172597543.1 | protein phosphatase CheZ | - |
EL244_RS06535 | 1463916..1464263 | - | 348 | WP_006813437.1 | HNH nuclease YajD | - |
EL244_RS06540 | 1464534..1465685 | + | 1152 | WP_006813436.1 | flagellar type III secretion system protein FlhB | - |
EL244_RS06545 | 1465678..1467774 | + | 2097 | WP_126459602.1 | flagellar biosynthesis protein FlhA | - |
EL244_RS06550 | 1467916..1468302 | + | 387 | WP_126459605.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL244_RS06555 | 1468295..1468615 | + | 321 | WP_006813433.1 | helix-turn-helix domain-containing protein | Antitoxin |
EL244_RS06560 | 1468653..1469093 | - | 441 | WP_126459608.1 | flagellar export chaperone FlgN | - |
EL244_RS06565 | 1469105..1469407 | - | 303 | WP_006813431.1 | anti-sigma-28 factor FlgM | - |
EL244_RS06570 | 1469618..1470286 | - | 669 | WP_006813429.1 | flagellar basal body P-ring formation protein FlgA | - |
EL244_RS06575 | 1470518..1470931 | + | 414 | WP_006813427.1 | flagellar basal body rod protein FlgB | - |
EL244_RS06580 | 1470937..1471341 | + | 405 | WP_006813426.1 | flagellar basal body rod protein FlgC | - |
EL244_RS06585 | 1471354..1472211 | + | 858 | WP_115164158.1 | flagellar basal-body rod modification protein | - |
EL244_RS06590 | 1472242..1473462 | + | 1221 | WP_126459611.1 | flagellar hook protein FlgE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14374.95 Da Isoelectric Point: 10.1566
>T287859 WP_126459605.1 NZ_LR134396:1467916-1468302 [Providencia rustigianii]
MAIYKTKIFKSKLKKLELDEIDVLLAAKQVLSGCYEADLGGGVIKKRLAIQGVGKRAGIRTIIFYKQGSHLFFADGWSKS
RLASKGRKEIEDDDLESYKDIARILLNSDPMKIAHMLKTGYLIEVKNV
MAIYKTKIFKSKLKKLELDEIDVLLAAKQVLSGCYEADLGGGVIKKRLAIQGVGKRAGIRTIIFYKQGSHLFFADGWSKS
RLASKGRKEIEDDDLESYKDIARILLNSDPMKIAHMLKTGYLIEVKNV
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|