Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 855819..856462 | Replicon | chromosome |
| Accession | NZ_LR134396 | ||
| Organism | Providencia rustigianii strain NCTC8113 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D1P676 |
| Locus tag | EL244_RS03830 | Protein ID | WP_006815740.1 |
| Coordinates | 855819..856022 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | D1P675 |
| Locus tag | EL244_RS03835 | Protein ID | WP_006815739.1 |
| Coordinates | 856094..856462 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL244_RS03810 | 851804..853588 | + | 1785 | WP_126458871.1 | SmdB family multidrug efflux ABC transporter permease/ATP-binding protein | - |
| EL244_RS03815 | 853695..854561 | - | 867 | WP_006815742.1 | acyl-CoA thioesterase II | - |
| EL244_RS03820 | 854804..855262 | + | 459 | WP_126458874.1 | YbaY family lipoprotein | - |
| EL244_RS03830 | 855819..856022 | - | 204 | WP_006815740.1 | hemolysin expression modulator Hha | Toxin |
| EL244_RS03835 | 856094..856462 | - | 369 | WP_006815739.1 | Hha toxicity modulator TomB | Antitoxin |
| EL244_RS03840 | 856990..858366 | - | 1377 | WP_126458877.1 | murein transglycosylase D | - |
| EL244_RS03845 | 858450..859202 | - | 753 | WP_126458880.1 | hydroxyacylglutathione hydrolase | - |
| EL244_RS03850 | 859237..859962 | + | 726 | WP_126458883.1 | class I SAM-dependent methyltransferase | - |
| EL244_RS03855 | 859971..860441 | - | 471 | WP_006815735.1 | ribonuclease HI | - |
| EL244_RS03860 | 860496..861257 | + | 762 | WP_006815734.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8087.38 Da Isoelectric Point: 6.9770
>T287857 WP_006815740.1 NZ_LR134396:c856022-855819 [Providencia rustigianii]
MTKSDYLMRLRKCTTLETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MTKSDYLMRLRKCTTLETLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14120.98 Da Isoelectric Point: 4.3849
>AT287857 WP_006815739.1 NZ_LR134396:c856462-856094 [Providencia rustigianii]
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTTTHWINDLSSPLSVSLNELVEHITSFVWRFKIKYPKENLVISLVEEYL
DETYDLFGSPVITFSEITDWESMNQNLVAVLDDDLKCLTSKT
MDEYSPKKHDIAELKYLCNSLNRDAISSLQKTTTHWINDLSSPLSVSLNELVEHITSFVWRFKIKYPKENLVISLVEEYL
DETYDLFGSPVITFSEITDWESMNQNLVAVLDDDLKCLTSKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A379G0S0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A379G117 |