Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 1458419..1459072 | Replicon | chromosome |
Accession | NZ_LR134395 | ||
Organism | Haemophilus aegyptius strain NCTC8134 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | EL190_RS07705 | Protein ID | WP_006996056.1 |
Coordinates | 1458680..1459072 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A5C2R5S0 |
Locus tag | EL190_RS07700 | Protein ID | WP_006996057.1 |
Coordinates | 1458419..1458679 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL190_RS07685 | 1454270..1455235 | - | 966 | WP_006996060.1 | tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB | - |
EL190_RS07690 | 1455232..1456746 | - | 1515 | WP_006996059.1 | sodium/proline symporter PutP | - |
EL190_RS07695 | 1456861..1458336 | + | 1476 | WP_006996058.1 | ribonuclease G | - |
EL190_RS07700 | 1458419..1458679 | + | 261 | WP_006996057.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL190_RS07705 | 1458680..1459072 | + | 393 | WP_006996056.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL190_RS07710 | 1459424..1460946 | + | 1523 | Protein_1470 | YadA-like family protein | - |
EL190_RS07715 | 1461112..1462779 | + | 1668 | WP_006996054.1 | glutamine--tRNA ligase | - |
EL190_RS07720 | 1462858..1463289 | + | 432 | WP_167395599.1 | YcgN family cysteine cluster protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14758.20 Da Isoelectric Point: 4.6908
>T287853 WP_006996056.1 NZ_LR134395:1458680-1459072 [Haemophilus aegyptius]
MYMLDTNTVSYFFRKVPSVVERLRLLNPEILCISSVTAAELFYGVAKRNNLQLSQFLDIFLSAISILEWDTKTAEIYGKL
RAEMEKEGKVMGVQDQMIAAHALANECVLVTSDKAFEFVPNLILENWCSV
MYMLDTNTVSYFFRKVPSVVERLRLLNPEILCISSVTAAELFYGVAKRNNLQLSQFLDIFLSAISILEWDTKTAEIYGKL
RAEMEKEGKVMGVQDQMIAAHALANECVLVTSDKAFEFVPNLILENWCSV
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|