Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 401041..401689 | Replicon | chromosome |
Accession | NZ_LR134395 | ||
Organism | Haemophilus aegyptius strain NCTC8134 |
Toxin (Protein)
Gene name | toxT | Uniprot ID | A0A0Y7JUP0 |
Locus tag | EL190_RS02145 | Protein ID | WP_005694481.1 |
Coordinates | 401041..401400 (+) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | EL190_RS02150 | Protein ID | WP_005650837.1 |
Coordinates | 401393..401689 (+) | Length | 99 a.a. |
Genomic Context
Location: 397696..400780 (3085 bp)
Type: Others
Protein ID: Protein_409
Type: Others
Protein ID: Protein_409
Location: 401041..401400 (360 bp)
Type: Toxin
Protein ID: WP_005694481.1
Type: Toxin
Protein ID: WP_005694481.1
Location: 401393..401689 (297 bp)
Type: Antitoxin
Protein ID: WP_005650837.1
Type: Antitoxin
Protein ID: WP_005650837.1
Location: 401850..403766 (1917 bp)
Type: Others
Protein ID: WP_006995317.1
Type: Others
Protein ID: WP_006995317.1
Location: 403776..404312 (537 bp)
Type: Others
Protein ID: WP_006995316.1
Type: Others
Protein ID: WP_006995316.1
Location: 404328..404879 (552 bp)
Type: Others
Protein ID: WP_006995315.1
Type: Others
Protein ID: WP_006995315.1
Location: 404883..405689 (807 bp)
Type: Others
Protein ID: WP_006995314.1
Type: Others
Protein ID: WP_006995314.1
Location: 405701..406453 (753 bp)
Type: Others
Protein ID: WP_006995313.1
Type: Others
Protein ID: WP_006995313.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL190_RS02140 | 397696..400780 | + | 3085 | Protein_409 | TonB-dependent hemoglobin/transferrin/lactoferrin family receptor | - |
EL190_RS02145 | 401041..401400 | + | 360 | WP_005694481.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL190_RS02150 | 401393..401689 | + | 297 | WP_005650837.1 | helix-turn-helix transcriptional regulator | Antitoxin |
EL190_RS02155 | 401850..403766 | + | 1917 | WP_006995317.1 | ABC transporter ATP-binding protein | - |
EL190_RS02160 | 403776..404312 | + | 537 | WP_006995316.1 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
EL190_RS02165 | 404328..404879 | + | 552 | WP_006995315.1 | Sua5/YciO/YrdC/YwlC family protein | - |
EL190_RS02170 | 404883..405689 | + | 807 | WP_006995314.1 | shikimate dehydrogenase | - |
EL190_RS02175 | 405701..406453 | + | 753 | WP_006995313.1 | DUF3800 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 14321.67 Da Isoelectric Point: 10.1408
>T287851 WP_005694481.1 NZ_LR134395:401041-401400 [Haemophilus aegyptius]
MYEILFYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLLSELGTSVGKPYVKHLDGEIWELRPIRDRILFARLM
DGRFVLLHQFMKKTQKTPKREIQTAQQRLSELKERLKNE
MYEILFYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLLSELGTSVGKPYVKHLDGEIWELRPIRDRILFARLM
DGRFVLLHQFMKKTQKTPKREIQTAQQRLSELKERLKNE
Download Length: 360 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0Y7JUP0 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |