Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 956599..957228 | Replicon | chromosome |
Accession | NZ_LR134394 | ||
Organism | Listeria ivanovii subsp. londoniensis strain NCTC12701 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A097BBV7 |
Locus tag | EL212_RS04480 | Protein ID | WP_025279828.1 |
Coordinates | 956881..957228 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | H1GC21 |
Locus tag | EL212_RS04475 | Protein ID | WP_003761302.1 |
Coordinates | 956599..956877 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL212_RS04455 | 951937..953409 | + | 1473 | WP_003719081.1 | PH domain-containing protein | - |
EL212_RS04460 | 953532..954911 | + | 1380 | WP_003719082.1 | protoporphyrinogen oxidase | - |
EL212_RS04465 | 954913..955269 | + | 357 | WP_003719083.1 | holo-ACP synthase | - |
EL212_RS04470 | 955287..956393 | + | 1107 | WP_038408703.1 | alanine racemase | - |
EL212_RS04475 | 956599..956877 | + | 279 | WP_003761302.1 | CopG family ribbon-helix-helix protein | Antitoxin |
EL212_RS04480 | 956881..957228 | + | 348 | WP_025279828.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
EL212_RS04485 | 957478..958314 | + | 837 | WP_038406970.1 | STAS domain-containing protein | - |
EL212_RS04490 | 958320..958676 | + | 357 | WP_003719089.1 | STAS domain-containing protein | - |
EL212_RS04495 | 958679..959089 | + | 411 | WP_074673827.1 | anti-sigma regulatory factor | - |
EL212_RS04500 | 959106..960110 | + | 1005 | WP_003719091.1 | PP2C family protein-serine/threonine phosphatase | - |
EL212_RS04505 | 960260..960604 | + | 345 | WP_038406972.1 | anti sigma b factor antagonist RsbV | - |
EL212_RS04510 | 960588..961061 | + | 474 | WP_038406973.1 | anti-sigma B factor RsbW | - |
EL212_RS04515 | 961039..961818 | + | 780 | WP_003719094.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12829.90 Da Isoelectric Point: 6.4735
>T287849 WP_025279828.1 NZ_LR134394:956881-957228 [Listeria ivanovii subsp. londoniensis]
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMVKVNQALEVSLGVVEF
MMVKRGDVYYADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAKIQKAKLPTHVEATRKDGFERDSVILLEQIR
TIDKQRLTDKITHLDEELMVKVNQALEVSLGVVEF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A097BBV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | H1GC21 |