Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | NpoTA/ParE(toxin) |
Location | 2930878..2931920 | Replicon | chromosome |
Accession | NZ_LR134383 | ||
Organism | Legionella jordanis strain NCTC11533 |
Toxin (Protein)
Gene name | NpoT | Uniprot ID | - |
Locus tag | EL203_RS14470 | Protein ID | WP_058472256.1 |
Coordinates | 2930878..2931036 (-) | Length | 53 a.a. |
Antitoxin (Protein)
Gene name | NpoA | Uniprot ID | A0A0W0VD64 |
Locus tag | EL203_RS13265 | Protein ID | WP_058471765.1 |
Coordinates | 2931057..2931920 (-) | Length | 288 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL203_RS13230 | 2926301..2926579 | - | 279 | WP_058471771.1 | hypothetical protein | - |
EL203_RS13235 | 2926852..2927109 | + | 258 | WP_058471770.1 | hypothetical protein | - |
EL203_RS13240 | 2927154..2927396 | - | 243 | WP_058471769.1 | hypothetical protein | - |
EL203_RS13245 | 2927528..2927686 | + | 159 | WP_197723118.1 | DUF3309 domain-containing protein | - |
EL203_RS13250 | 2927728..2928576 | - | 849 | WP_058471768.1 | class II glutamine amidotransferase | - |
EL203_RS13255 | 2928644..2929936 | - | 1293 | WP_058471767.1 | MFS transporter | - |
EL203_RS13260 | 2930096..2930848 | + | 753 | WP_058471766.1 | endonuclease/exonuclease/phosphatase family protein | - |
EL203_RS14470 | 2930878..2931036 | - | 159 | WP_058472256.1 | hypothetical protein | Toxin |
EL203_RS13265 | 2931057..2931920 | - | 864 | WP_058471765.1 | SDR family oxidoreductase | Antitoxin |
EL203_RS13270 | 2931973..2932329 | - | 357 | WP_058471764.1 | PRC-barrel domain-containing protein | - |
EL203_RS13275 | 2932341..2933024 | - | 684 | WP_058471763.1 | BON domain-containing protein | - |
EL203_RS13280 | 2933412..2934272 | + | 861 | WP_058471762.1 | Ku protein | - |
EL203_RS13285 | 2934637..2936919 | + | 2283 | WP_058471761.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6042.70 Da Isoelectric Point: 10.3195
>T287845 WP_058472256.1 NZ_LR134383:c2931036-2930878 [Legionella jordanis]
MAQGDKSKYTDKQKRKAHHIEEHYRDKGVSKQEAEKRAWATVNEQDKGGKKS
MAQGDKSKYTDKQKRKAHHIEEHYRDKGVSKQEAEKRAWATVNEQDKGGKKS
Download Length: 159 bp
Antitoxin
Download Length: 288 a.a. Molecular weight: 31252.39 Da Isoelectric Point: 5.5832
>AT287845 WP_058471765.1 NZ_LR134383:c2931920-2931057 [Legionella jordanis]
MPHGKQQQPPQHQAKQPGIEAFMHPKPEYISPQYKGSDKLLGKKALITGGDSGIGRAVACAFALEGADVVIQYLNTEQQD
AEETKEFIENAGRKCWLLPSPLDSYEVCEQLVKRALEACSHINILVNNAAEQHPKGSVDEISPEQLEQTFRTNFFAYFYM
VKSLLPHMEKGDVIINTTSVTAYKGSEHLIDYSATKGAILAFTRSLSQNLISKGIRVNGVAPGPIWTPLIPASFTADEVE
EFGSQVPMSRAGQPSEVAPSYVFLASADSSYMTGQVLHPNGGVIVNS
MPHGKQQQPPQHQAKQPGIEAFMHPKPEYISPQYKGSDKLLGKKALITGGDSGIGRAVACAFALEGADVVIQYLNTEQQD
AEETKEFIENAGRKCWLLPSPLDSYEVCEQLVKRALEACSHINILVNNAAEQHPKGSVDEISPEQLEQTFRTNFFAYFYM
VKSLLPHMEKGDVIINTTSVTAYKGSEHLIDYSATKGAILAFTRSLSQNLISKGIRVNGVAPGPIWTPLIPASFTADEVE
EFGSQVPMSRAGQPSEVAPSYVFLASADSSYMTGQVLHPNGGVIVNS
Download Length: 864 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|