Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 557821..558361 Replicon chromosome
Accession NZ_LR134383
Organism Legionella jordanis strain NCTC11533

Toxin (Protein)


Gene name mazF Uniprot ID A0A0W0V9P5
Locus tag EL203_RS02655 Protein ID WP_058470648.1
Coordinates 557821..558141 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A0W0V9L2
Locus tag EL203_RS02660 Protein ID WP_058470647.1
Coordinates 558128..558361 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL203_RS02625 553134..553474 - 341 Protein_511 GGDEF domain-containing protein -
EL203_RS02630 553792..554466 - 675 WP_197723125.1 MBL fold metallo-hydrolase -
EL203_RS02635 554492..555283 - 792 WP_058470652.1 sulfite exporter TauE/SafE family protein -
EL203_RS02640 555287..555838 - 552 WP_058470651.1 rhodanese-like domain-containing protein -
EL203_RS02645 557056..557430 + 375 WP_058470650.1 hypothetical protein -
EL203_RS02650 557436..557729 - 294 WP_058470649.1 hypothetical protein -
EL203_RS02655 557821..558141 - 321 WP_058470648.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL203_RS02660 558128..558361 - 234 WP_058470647.1 hypothetical protein Antitoxin
EL203_RS02665 558429..559402 + 974 Protein_519 helicase -
EL203_RS02670 559415..559903 - 489 WP_058470645.1 autoinducer binding domain-containing protein -
EL203_RS02675 559977..561179 + 1203 WP_058470644.1 MFS transporter -
EL203_RS02680 561182..561526 + 345 WP_058470643.1 DUF4286 family protein -
EL203_RS02690 561865..562587 - 723 WP_058470642.1 gamma-glutamylcyclotransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 511621..562743 51122
- flank IS/Tn - - 552370..553050 680


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-104)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 11403.22 Da        Isoelectric Point: 8.9243

>T287844 WP_058470648.1 NZ_LR134383:c558141-557821 [Legionella jordanis]
MNRGDVYWVNLDPTTGSEINKLRPCVLVGATPINQARRTVVVVPLSTSATARPPITISVSCLGKQVTAVCDQIRTVDKSR
LKNVAGSLSDKDLNALDDGLRQILCL

Download         Length: 321 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 9031.27 Da        Isoelectric Point: 4.8430

>AT287844 WP_058470647.1 NZ_LR134383:c558361-558128 [Legionella jordanis]
MNKVLISIPDQIASRMRAAIPQRQRSKVIAHLIEKEVERREKALYQCALAVENDQDLKEEMEDWNVTIQDGLHDESW

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0W0V9P5

Antitoxin

Source ID Structure
AlphaFold DB A0A0W0V9L2

References