Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 4065172..4065745 | Replicon | chromosome |
| Accession | NZ_LR134382 | ||
| Organism | Bordetella hinzii strain NCTC13199 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | W5IUR0 |
| Locus tag | EL326_RS19215 | Protein ID | WP_009618209.1 |
| Coordinates | 4065172..4065459 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | EL326_RS19220 | Protein ID | WP_060833063.1 |
| Coordinates | 4065446..4065745 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL326_RS19190 | 4060786..4062828 | - | 2043 | WP_060833067.1 | DNA topoisomerase III | - |
| EL326_RS19195 | 4063124..4063507 | - | 384 | WP_060833066.1 | single-stranded DNA-binding protein | - |
| EL326_RS19200 | 4063504..4064052 | - | 549 | WP_060833065.1 | DUF3158 family protein | - |
| EL326_RS19205 | 4064049..4064828 | - | 780 | WP_060833064.1 | TIGR03761 family integrating conjugative element protein | - |
| EL326_RS19210 | 4064952..4065143 | - | 192 | WP_011805449.1 | hypothetical protein | - |
| EL326_RS19215 | 4065172..4065459 | - | 288 | WP_009618209.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL326_RS19220 | 4065446..4065745 | - | 300 | WP_060833063.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL326_RS19225 | 4065873..4067066 | - | 1194 | WP_060833062.1 | hypothetical protein | - |
| EL326_RS19230 | 4067069..4067629 | - | 561 | WP_020651215.1 | DUF2857 domain-containing protein | - |
| EL326_RS19235 | 4067647..4069305 | - | 1659 | WP_060833061.1 | ParB N-terminal domain-containing protein | - |
| EL326_RS19240 | 4069298..4069546 | - | 249 | WP_020651217.1 | hypothetical protein | - |
| EL326_RS19245 | 4069530..4070396 | - | 867 | WP_060833060.1 | ParA family protein | - |
| EL326_RS19250 | 4070438..4070656 | - | 219 | WP_060833059.1 | AlpA family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10854.46 Da Isoelectric Point: 8.4628
>T287843 WP_009618209.1 NZ_LR134382:c4065459-4065172 [Bordetella hinzii]
VRVLEWREAARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPERPKLYRPGRVAGTREMVVRANYVVVYMEDTRAVSI
LRVLHAAQQWPPARE
VRVLEWREAARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPERPKLYRPGRVAGTREMVVRANYVVVYMEDTRAVSI
LRVLHAAQQWPPARE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|