Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 1186419..1186986 | Replicon | chromosome |
| Accession | NZ_LR134379 | ||
| Organism | Slackia heliotrinireducens strain NCTC11029 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C7N5J1 |
| Locus tag | EL225_RS05215 | Protein ID | WP_012798279.1 |
| Coordinates | 1186705..1186986 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | C7N5J0 |
| Locus tag | EL225_RS05210 | Protein ID | WP_012798278.1 |
| Coordinates | 1186419..1186697 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL225_RS05185 | 1182016..1182903 | + | 888 | WP_012798273.1 | proline iminopeptidase-family hydrolase | - |
| EL225_RS05190 | 1183161..1183652 | + | 492 | WP_012798274.1 | RNA polymerase sigma factor | - |
| EL225_RS05195 | 1183649..1184764 | + | 1116 | WP_012798275.1 | zf-HC2 domain-containing protein | - |
| EL225_RS05200 | 1184922..1185131 | + | 210 | WP_012798276.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| EL225_RS05205 | 1185128..1186318 | + | 1191 | WP_012798277.1 | glycosyltransferase MGT family | - |
| EL225_RS05210 | 1186419..1186697 | + | 279 | WP_012798278.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL225_RS05215 | 1186705..1186986 | + | 282 | WP_012798279.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| EL225_RS05220 | 1187285..1187485 | - | 201 | WP_041422733.1 | TM2 domain-containing protein | - |
| EL225_RS05225 | 1187744..1188133 | + | 390 | WP_012798281.1 | (deoxy)nucleoside triphosphate pyrophosphohydrolase | - |
| EL225_RS05230 | 1188139..1191063 | - | 2925 | WP_012798282.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10758.40 Da Isoelectric Point: 9.0911
>T287840 WP_012798279.1 NZ_LR134379:1186705-1186986 [Slackia heliotrinireducens]
MSLKLVPTSQFKKDYKRAKKRGLDMRKLQAVLDKLCAEEPLDERHRDHALSGNYIGFRECHVSPDWLLIYAIDKGRLILT
ASRTGTHSDLFDE
MSLKLVPTSQFKKDYKRAKKRGLDMRKLQAVLDKLCAEEPLDERHRDHALSGNYIGFRECHVSPDWLLIYAIDKGRLILT
ASRTGTHSDLFDE
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|