Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/- |
Location | 2849671..2850311 | Replicon | chromosome |
Accession | NZ_LR134378 | ||
Organism | Lautropia mirabilis strain NCTC12852 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | E7RTK5 |
Locus tag | EL249_RS11705 | Protein ID | WP_005672112.1 |
Coordinates | 2849931..2850311 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | EL249_RS11700 | Protein ID | WP_005672114.1 |
Coordinates | 2849671..2849934 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL249_RS11680 | 2848427..2849005 | - | 579 | WP_005672118.1 | NUDIX hydrolase | - |
EL249_RS11690 | 2849145..2849435 | - | 291 | WP_005672116.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
EL249_RS11700 | 2849671..2849934 | + | 264 | WP_005672114.1 | DUF2191 domain-containing protein | Antitoxin |
EL249_RS11705 | 2849931..2850311 | + | 381 | WP_005672112.1 | PIN domain-containing protein | Toxin |
EL249_RS11710 | 2850343..2850951 | - | 609 | WP_005672111.1 | alpha/beta hydrolase | - |
EL249_RS11715 | 2851166..2853001 | + | 1836 | WP_005672110.1 | monovalent cation:proton antiporter-2 (CPA2) family protein | - |
EL249_RS11720 | 2853014..2853721 | + | 708 | WP_005672108.1 | YafY family transcriptional regulator | - |
EL249_RS11725 | 2853929..2854594 | + | 666 | WP_005672107.1 | glutathione S-transferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14263.62 Da Isoelectric Point: 7.0389
>T287839 WP_005672112.1 NZ_LR134378:2849931-2850311 [Lautropia mirabilis]
MTTRAILVDSSVWVDHFRHGNEALTTLLHQDRVLVHPFVIGEIACGTPPDRTRVLAWLAELRSTQICSLNELMAFIERHR
LYGLGCGLVDLMLLASTLMTENALLWTLDRRLNSLAERFGIAHTVR
MTTRAILVDSSVWVDHFRHGNEALTTLLHQDRVLVHPFVIGEIACGTPPDRTRVLAWLAELRSTQICSLNELMAFIERHR
LYGLGCGLVDLMLLASTLMTENALLWTLDRRLNSLAERFGIAHTVR
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|