Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2690055..2690677 | Replicon | chromosome |
Accession | NZ_LR134378 | ||
Organism | Lautropia mirabilis strain NCTC12852 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | E7RTZ0 |
Locus tag | EL249_RS11035 | Protein ID | WP_005672357.1 |
Coordinates | 2690055..2690237 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | E7RTY9 |
Locus tag | EL249_RS11040 | Protein ID | WP_005672355.1 |
Coordinates | 2690258..2690677 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL249_RS11005 | 2685770..2686423 | - | 654 | WP_005672367.1 | DUF799 family lipoprotein | - |
EL249_RS11010 | 2686420..2686839 | - | 420 | WP_005672366.1 | DUF4810 domain-containing protein | - |
EL249_RS11015 | 2686850..2687521 | - | 672 | WP_040529635.1 | CsgG/HfaB family protein | - |
EL249_RS11020 | 2687707..2687955 | + | 249 | WP_005672363.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
EL249_RS11025 | 2687952..2688338 | + | 387 | WP_005672361.1 | type II toxin-antitoxin system VapC family toxin | - |
EL249_RS11030 | 2688470..2689756 | - | 1287 | WP_005672358.1 | glutamate-1-semialdehyde 2,1-aminomutase | - |
EL249_RS11035 | 2690055..2690237 | + | 183 | WP_005672357.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
EL249_RS11040 | 2690258..2690677 | + | 420 | WP_005672355.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
EL249_RS11045 | 2690745..2691875 | - | 1131 | WP_005672352.1 | molecular chaperone DnaJ | - |
EL249_RS11050 | 2692066..2694021 | - | 1956 | WP_005672350.1 | molecular chaperone DnaK | - |
EL249_RS11055 | 2694251..2694988 | - | 738 | WP_083799601.1 | nucleotide exchange factor GrpE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6698.85 Da Isoelectric Point: 11.3859
>T287838 WP_005672357.1 NZ_LR134378:2690055-2690237 [Lautropia mirabilis]
MGSKELIKLIEAHGWHLVATRGSHRQYKHPTLPGRVTIPHPNKDLPRGTVQSILKQAGLK
MGSKELIKLIEAHGWHLVATRGSHRQYKHPTLPGRVTIPHPNKDLPRGTVQSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15473.28 Da Isoelectric Point: 4.3475
>AT287838 WP_005672355.1 NZ_LR134378:2690258-2690677 [Lautropia mirabilis]
MLIPVAIHKDTDSLYGVTVPDIPGCFSAGETIEEALSNTREAIVFHLEGMLEDGEAVTVSTRQIEELAQEADYAGATWAL
IDVDLQRLSLKQTRFNVSWPEYLLARIDAYAEAHHETRSGLLAKAAERYLSEQRAHETN
MLIPVAIHKDTDSLYGVTVPDIPGCFSAGETIEEALSNTREAIVFHLEGMLEDGEAVTVSTRQIEELAQEADYAGATWAL
IDVDLQRLSLKQTRFNVSWPEYLLARIDAYAEAHHETRSGLLAKAAERYLSEQRAHETN
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|