Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-stbD/ParE(toxin) |
Location | 1171433..1171968 | Replicon | chromosome |
Accession | NZ_LR134378 | ||
Organism | Lautropia mirabilis strain NCTC12852 |
Toxin (Protein)
Gene name | relE | Uniprot ID | E7RYC5 |
Locus tag | EL249_RS04775 | Protein ID | WP_005674013.1 |
Coordinates | 1171433..1171717 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | E7RYC4 |
Locus tag | EL249_RS04780 | Protein ID | WP_005674012.1 |
Coordinates | 1171714..1171968 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL249_RS04760 | 1166905..1168395 | + | 1491 | WP_040531585.1 | M48 family metalloprotease | - |
EL249_RS04765 | 1168402..1170054 | - | 1653 | WP_005674015.1 | DUF3459 domain-containing protein | - |
EL249_RS04770 | 1170051..1171340 | - | 1290 | WP_005674014.1 | ABC transporter substrate-binding protein | - |
EL249_RS04775 | 1171433..1171717 | - | 285 | WP_005674013.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
EL249_RS04780 | 1171714..1171968 | - | 255 | WP_005674012.1 | hypothetical protein | Antitoxin |
EL249_RS04785 | 1171992..1172429 | - | 438 | WP_050781906.1 | DUF3225 domain-containing protein | - |
EL249_RS04790 | 1172485..1172688 | - | 204 | WP_005674010.1 | zinc-finger domain-containing protein | - |
EL249_RS04795 | 1172926..1173852 | - | 927 | WP_005674008.1 | branched-chain amino acid transaminase | - |
EL249_RS04800 | 1174065..1176881 | - | 2817 | WP_005674007.1 | bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11016.00 Da Isoelectric Point: 10.6292
>T287835 WP_005674013.1 NZ_LR134378:c1171717-1171433 [Lautropia mirabilis]
MKYQLTFNPQALKEFRKLGANIANQFLDKLEERLQNPKVPSARLIGMADCYKIKLRSSGYRLVYQVQDEKIIVQVIAVGK
RERMEVYQKAARRL
MKYQLTFNPQALKEFRKLGANIANQFLDKLEERLQNPKVPSARLIGMADCYKIKLRSSGYRLVYQVQDEKIIVQVIAVGK
RERMEVYQKAARRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|