Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1079460..1080133 | Replicon | chromosome |
| Accession | NZ_LR134378 | ||
| Organism | Lautropia mirabilis strain NCTC12852 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | E7RYK3 |
| Locus tag | EL249_RS04375 | Protein ID | WP_005674101.1 |
| Coordinates | 1079460..1079882 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | E7RYK2 |
| Locus tag | EL249_RS04380 | Protein ID | WP_005674100.1 |
| Coordinates | 1079879..1080133 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL249_RS04355 | 1074778..1075449 | - | 672 | WP_005674105.1 | molybdate ABC transporter permease subunit | - |
| EL249_RS04360 | 1075462..1076223 | - | 762 | WP_040530017.1 | molybdate ABC transporter substrate-binding protein | - |
| EL249_RS04365 | 1076438..1078360 | + | 1923 | WP_005674103.1 | TonB-dependent receptor | - |
| EL249_RS04370 | 1078417..1079475 | - | 1059 | WP_005674102.1 | alpha/beta hydrolase | - |
| EL249_RS04375 | 1079460..1079882 | - | 423 | WP_005674101.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EL249_RS04380 | 1079879..1080133 | - | 255 | WP_005674100.1 | hypothetical protein | Antitoxin |
| EL249_RS04385 | 1080270..1081577 | - | 1308 | WP_040531651.1 | pyridoxal phosphate-dependent aminotransferase | - |
| EL249_RS04390 | 1081755..1082252 | - | 498 | WP_040530014.1 | thiol peroxidase | - |
| EL249_RS04395 | 1082409..1084016 | - | 1608 | WP_005674097.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15257.72 Da Isoelectric Point: 6.7543
>T287834 WP_005674101.1 NZ_LR134378:c1079882-1079460 [Lautropia mirabilis]
MILLDTNVISEPMRREPEARVLAWLDRQPSETLFLSAITVAEIRKGIALLPAGKRQTLLAERLDKLLLPMFHGRILPFDI
HTTPAYASVIAHAAAAGCTIAAADGFIAAIALQHHFSVATRDTHPFQAAGLDVINPWTTD
MILLDTNVISEPMRREPEARVLAWLDRQPSETLFLSAITVAEIRKGIALLPAGKRQTLLAERLDKLLLPMFHGRILPFDI
HTTPAYASVIAHAAAAGCTIAAADGFIAAIALQHHFSVATRDTHPFQAAGLDVINPWTTD
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|