Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 696511..697151 | Replicon | chromosome |
Accession | NZ_LR134378 | ||
Organism | Lautropia mirabilis strain NCTC12852 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | - |
Locus tag | EL249_RS02795 | Protein ID | WP_197721597.1 |
Coordinates | 696511..696909 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | EL249_RS02800 | Protein ID | WP_040531898.1 |
Coordinates | 696915..697151 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL249_RS02775 | 693188..693715 | - | 528 | WP_005674482.1 | anaerobic ribonucleoside-triphosphate reductase activating protein | - |
EL249_RS02780 | 694085..694857 | - | 773 | Protein_541 | HipA domain-containing protein | - |
EL249_RS02785 | 694807..695031 | + | 225 | WP_083799546.1 | helix-turn-helix domain-containing protein | - |
EL249_RS02790 | 695024..696442 | + | 1419 | WP_083799545.1 | zinc ribbon domain-containing protein | - |
EL249_RS02795 | 696511..696909 | - | 399 | WP_197721597.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL249_RS02800 | 696915..697151 | - | 237 | WP_040531898.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL249_RS02805 | 697206..697394 | + | 189 | WP_197721598.1 | hypothetical protein | - |
EL249_RS02810 | 697399..698460 | - | 1062 | WP_005674476.1 | NAD(P)-dependent alcohol dehydrogenase | - |
EL249_RS02815 | 698484..699443 | - | 960 | WP_126348062.1 | hypothetical protein | - |
EL249_RS02820 | 699756..700397 | - | 642 | WP_005674472.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15295.37 Da Isoelectric Point: 7.9466
>T287833 WP_197721597.1 NZ_LR134378:c696909-696511 [Lautropia mirabilis]
MLDTNIIIYLMKNRPESVARKISSLAPHDRIVMSFVTYGELLQGAEGSRDRKKSHDNIRRITQRIQILYPDENTCIHYGH
WAETLKRQGRPIGNNDLWIACHALSAGATLVTHNSREFARIEDLNWQDWVEP
MLDTNIIIYLMKNRPESVARKISSLAPHDRIVMSFVTYGELLQGAEGSRDRKKSHDNIRRITQRIQILYPDENTCIHYGH
WAETLKRQGRPIGNNDLWIACHALSAGATLVTHNSREFARIEDLNWQDWVEP
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|