Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2108438..2109075 | Replicon | chromosome |
Accession | NZ_LR134375 | ||
Organism | Veillonella dispar strain NCTC11831 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | C4FMJ6 |
Locus tag | EL171_RS09865 | Protein ID | WP_005384837.1 |
Coordinates | 2108665..2109075 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C4FMM5 |
Locus tag | EL171_RS09860 | Protein ID | WP_005384838.1 |
Coordinates | 2108438..2108668 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL171_RS09850 | 2105983..2106840 | + | 858 | WP_024063815.1 | methylenetetrahydrofolate reductase | - |
EL171_RS09855 | 2106988..2107740 | - | 753 | WP_005384840.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
EL171_RS09860 | 2108438..2108668 | + | 231 | WP_005384838.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
EL171_RS09865 | 2108665..2109075 | + | 411 | WP_005384837.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
EL171_RS09870 | 2109153..2111024 | - | 1872 | WP_005384835.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG | - |
EL171_RS09875 | 2111138..2112523 | - | 1386 | WP_005384833.1 | tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE | - |
EL171_RS09880 | 2112713..2113501 | - | 789 | WP_005384831.1 | protein jag | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15333.83 Da Isoelectric Point: 7.3820
>T287832 WP_005384837.1 NZ_LR134375:2108665-2109075 [Veillonella dispar]
MKYMLDTNICIYAIKQEPEVVLQKILKHHPSDICISSITYAELMHGVEKSQSKDKNRLALTLLLSPIQIIDFDSHAAEEY
GKIKADLQSQGKIIGPMDLLIASHAKSKGLTIVTNNTKEFKRVNQLEVEDWSKPLS
MKYMLDTNICIYAIKQEPEVVLQKILKHHPSDICISSITYAELMHGVEKSQSKDKNRLALTLLLSPIQIIDFDSHAAEEY
GKIKADLQSQGKIIGPMDLLIASHAKSKGLTIVTNNTKEFKRVNQLEVEDWSKPLS
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | C4FMJ6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S7YY19 |