Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3375370..3375990 | Replicon | chromosome |
Accession | NZ_LR134373 | ||
Organism | Yersinia pseudotuberculosis strain NCTC10275 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | Q66DR5 |
Locus tag | EL213_RS15370 | Protein ID | WP_002208622.1 |
Coordinates | 3375787..3375990 (+) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | Q66DR4 |
Locus tag | EL213_RS15365 | Protein ID | WP_002218472.1 |
Coordinates | 3375370..3375738 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL213_RS15350 | 3373575..3373835 | + | 261 | WP_002208617.1 | type B 50S ribosomal protein L31 | - |
EL213_RS15355 | 3373851..3373994 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
EL213_RS15360 | 3374858..3375211 | + | 354 | WP_002208619.1 | hypothetical protein | - |
EL213_RS15365 | 3375370..3375738 | + | 369 | WP_002218472.1 | Hha toxicity modulator TomB | Antitoxin |
EL213_RS15370 | 3375787..3375990 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
EL213_RS15380 | 3376860..3377249 | + | 390 | WP_024063215.1 | MGMT family protein | - |
EL213_RS15385 | 3377385..3377906 | - | 522 | WP_011191872.1 | YbaY family lipoprotein | - |
EL213_RS15390 | 3378163..3379023 | + | 861 | WP_002208625.1 | acyl-CoA thioesterase II | - |
EL213_RS15395 | 3379284..3380573 | - | 1290 | WP_002228344.1 | ammonium transporter AmtB | - |
EL213_RS15400 | 3380613..3380951 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T287828 WP_002208622.1 NZ_LR134373:3375787-3375990 [Yersinia pseudotuberculosis]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14215.00 Da Isoelectric Point: 4.6121
>AT287828 WP_002218472.1 NZ_LR134373:3375370-3375738 [Yersinia pseudotuberculosis]
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWINDPTSAINLQLNDLIEHIASFVMSFKIKYPDGSQLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKEHLFRLFSGEYVCTLMKT
MDEYSPKRHDIAQLKFLCESLYDEGIATLGDSHHGWINDPTSAINLQLNDLIEHIASFVMSFKIKYPDGSQLSELVEEYL
DDTYTLFSSYGINDPELRRWQKTKEHLFRLFSGEYVCTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|